Active Recombinant Rat Csf3 Protein

Cat.No. : Csf3-188C
Product Overview : Recombinant Rat Csf3 Protein without tag was expressed in HEK 293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Description : Among the family of colony-stimulating factors, Granulocyte Colony-Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation of leukemic myeloid cell lines into granulocytes and macrophages. G-CSF synthesis can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits G-CSF synthesis. In epithelial, endothelial, and fibroblastic cells, secretion of G-CSF is induced by Interleukin-17.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 5 pg/mL, measured in a cell proliferation assay using NFS-60 cells.
Molecular Mass : 25~28 kDa, observed by reducing SDS-PAGE.
AA Sequence : IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Rat Granulocyte Colony-Stimulating Factor (G-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Granulocyte Colony-Stimulating Factor (G-CSF) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Csf3 colony stimulating factor 3 (granulocyte) [ Rattus norvegicus ]
Official Symbol Csf3
Synonyms CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor;
Gene ID 25610
mRNA Refseq NM_017104
Protein Refseq NP_058800

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf3 Products

Required fields are marked with *

My Review for All Csf3 Products

Required fields are marked with *

0
cart-icon