Active Recombinant Rat Fgf2 Protein (146 aa)

Cat.No. : Fgf2-397F
Product Overview : Recombinant rat Fibroblast Growth Factor-basic (rrFGF-basic) produced in E. coli is a single non-glycosylated polypeptide chain containing 146 amino acids. A fully biologically active molecule, rrFGF-basic has a molecular mass of 16.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Protein Length : 146
Description : Fibroblast Growth Factor-basic (FGF-basic), also known as FGF-2, is a pleiotropic cytokine and one of the prototypic members of the heparin-binding FGF family. Like other FGF family members, FGF-basic has the β trefoil structure. In vivo, FGF-basic is produced by a variety of cells, including cardiomycotes, fibroblasts, and vascular cells. FGF-basic regulates a variety of processes including cell proliferation, differentiation, survival, adhesion, motility, apoptosis, limb formation and wound healing. FGF-basic can be tumorigenic due to its role in angiogenesis and blood vessel remodeling. The angiogenic effects of FGF-basic can produce beneficial cardioprotection during acute heart injury.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.25 ng/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 4 × 10^6 units/mg.
Molecular Mass : 16.4 kDa, observed by reducing SDS-PAGE.
AA Sequence : GPALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE analysis.
Storage : Lyophilized recombinant rat Fibroblast Growth Factor-basic (rrFGF-basic) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrFGF-basic remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Fgf2 fibroblast growth factor 2 [ Rattus norvegicus ]
Official Symbol Fgf2
Synonyms FGF2; fibroblast growth factor 2; HBGF-2; basic fibroblast growth factor; heparin-binding growth factor 2; bFGF; Fgf-2;
Gene ID 54250
mRNA Refseq NM_019305
Protein Refseq NP_062178
UniProt ID P13109

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fgf2 Products

Required fields are marked with *

My Review for All Fgf2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon