Active Recombinant Human FGF2 Protein

Cat.No. : FGF2-81H
Product Overview : Recombinant Human FGF2 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Basic fibroblast growth factor (FGF-basic), also known as FGF-2, is expressed by endothelial cells and is a mediator of angiogenesis. FGF-basic also has cardioprotective functions during heart injury. FGF-basic is a critical component for embryonic stem cell culture systems and is necessary for maintaining cells in an undifferentiated state. Degredation of the full length FGF-basic N-terminus results in a truncated FGF-basic 147aa protein, when the protein is isolated from biological sources. The N-terminus extensions influence the localization of FGF-basic within the cell, but do not affect the biological activity of FGF-basic. Therefore, there are no detectable differences in biological activity between the full length FGF-basic 154aa and the truncated FGF-basic 147aa recombinant proteins.
Bio-activity : 3T3 cell proliferation, ≤5 ng/mL; ≥2.0 x 10^5 units/mg
Molecular Mass : Monomer, 16.5 kDa (147 aa)
AA Sequence : MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mm sodium phosphate, 75 mM sodium chloride, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name FGF2 fibroblast growth factor 2 (basic) [ Homo sapiens (human) ]
Official Symbol FGF2
Synonyms FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2;
Gene ID 2247
mRNA Refseq NM_002006
Protein Refseq NP_001997
MIM 134920
UniProt ID P09038

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF2 Products

Required fields are marked with *

My Review for All FGF2 Products

Required fields are marked with *

0
cart-icon
0
compare icon