Species : |
Human |
Source : |
E.coli |
Description : |
Basic fibroblast growth factor (FGF-basic), also known as FGF-2, is expressed by endothelial cells and is a mediator of angiogenesis. FGF-basic also has cardioprotective functions during heart injury. FGF-basic is a critical component for embryonic stem cell culture systems and is necessary for maintaining cells in an undifferentiated state. Degredation of the full length FGF-basic N-terminus results in a truncated FGF-basic 147aa protein, when the protein is isolated from biological sources. The N-terminus extensions influence the localization of FGF-basic within the cell, but do not affect the biological activity of FGF-basic. Therefore, there are no detectable differences in biological activity between the full length FGF-basic 154aa and the truncated FGF-basic 147aa recombinant proteins. |
Bio-activity : |
3T3 cell proliferation, ≤5 ng/mL; ≥2.0 x 10^5 units/mg |
Molecular Mass : |
Monomer, 16.5 kDa (147 aa) |
AA Sequence : |
MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Endotoxin : |
≤1 EUs/μg, Kinetic LAL |
Purity : |
≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : |
12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : |
Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : |
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mm sodium phosphate, 75 mM sodium chloride, pH 7.5 |
Reconstitution : |
Sterile water at 0.1 mg/mL |
Shipping : |
Room temperature |
Instructions : |
Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |