Active Recombinant Rat Il13 Protein (110 aa)

Cat.No. : Il13-008I
Product Overview : Recombinant Rat Il13 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Protein Length : 110
Description : IL-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 1-4 ng/mL.
Molecular Mass : Approximately 12.1 kDa, a single non-glycosylated polypeptide chain containing 110 amino acids.
AA Sequence : PVRRSTSPPVALRELIEELSNITQDQKTSLCNSSMVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH
Endotoxin : Less than 1 EU/μg of rRtIL-13 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il13 interleukin 13 [ Rattus norvegicus ]
Official Symbol Il13
Synonyms IL13; interleukin 13; interleukin-13; IL-13; T-cell activation protein P600;
Gene ID 116553
mRNA Refseq NM_053828
Protein Refseq NP_446280
UniProt ID P42203

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il13 Products

Required fields are marked with *

My Review for All Il13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon