Active Recombinant Rat Il13 Protein (110 aa)
Cat.No. : | Il13-008I |
Product Overview : | Recombinant Rat Il13 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 110 |
Description : | IL-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 1-4 ng/mL. |
Molecular Mass : | Approximately 12.1 kDa, a single non-glycosylated polypeptide chain containing 110 amino acids. |
AA Sequence : | PVRRSTSPPVALRELIEELSNITQDQKTSLCNSSMVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH |
Endotoxin : | Less than 1 EU/μg of rRtIL-13 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il13 interleukin 13 [ Rattus norvegicus ] |
Official Symbol | Il13 |
Synonyms | IL13; interleukin 13; interleukin-13; IL-13; T-cell activation protein P600; |
Gene ID | 116553 |
mRNA Refseq | NM_053828 |
Protein Refseq | NP_446280 |
UniProt ID | P42203 |
◆ Recombinant Proteins | ||
IL13-459H | Active Recombinant Human IL13 protein, hFc-tagged | +Inquiry |
Il13-629M | Recombinant Mouse Il13 protein | +Inquiry |
IL13-58C | Recombinant Chicken IL-13 | +Inquiry |
IL13-1568C | Active Recombinant Cynomolgus IL13 protein, His-tagged | +Inquiry |
IL13-7888Z | Recombinant Zebrafish IL13 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il13 Products
Required fields are marked with *
My Review for All Il13 Products
Required fields are marked with *
0
Inquiry Basket