"NGF" Related Products

Expand
Expand

Recombinant Human Nerve Growth Factor (beta polypeptide)

Cat. No.: NGF-1869H
Product Overview: Recombinant human NGFis a non-glycosylated, polypeptide chain containing 222 amino acids and has aMW = 49.8 kDa.
Description: NGF is critical forthe survival and maintenance of sympathetic and sensory nuerons and may playan important role in the regulation of the immune system . Nerve growthfactor (NGF) is a small secreted protein that is important for the growth,maintenance, and survival of certain target neurons (nerve cells). It alsofunctions as a signaling molecule.
Source: E. coli
Species: Human
Form: Liquid in a sterilefiltered buffer of 50 mM sodium phosphate, pH 7.2 + 150 mM sodium chloride.
MolecularWeight: 49.8 kDa
Purity: > 98% as determinedby RP-HPLC and SDS-PAGE.
Endotoxin Level: < 0.1 ng/µg ofthe protein.
Biological Activity: Determined by itsstimulation of the proliferation of TF1 cells (TF1 cell assay). The EC50 of130 ± 30 pM.
Sequence: MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAR
Storage: Centrifuge vialprior to opening Although stable for three weeks at ambient temperature,product should be stored at 2-4°C. For long term storage, it is recommendedto add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.
OfficialSymbol: NGF
Gene Name: NGF nerve growth factor (betapolypeptide) [ Homo sapiens ]
Synonyms: NGF; nerve growthfactor (beta polypeptide); NGFB; HSAN5; Beta-NGF; MGC161426; MGC161428;beta-nerve growth factor; OTTHUMP00000013653; nerve growth factor, betasubunit
Gene ID: 4803
mRNA Refseq: NM_002506
Protein Refseq: NP_002497
MIM: 162030
UniProt ID: P01138
Chromosome Location: 1p13.1
Pathway: ARMS-mediatedactivation; Cell death signalling via NRAGE; Frs2-mediated activation; MAPKsignaling pathway; NADE modulates death signalling; NRAGE signals deaththrough JNK; PLC-gamma1 signalling; Retrograde neurotrophin signalling;Retrograde neurotrophin signalling; Signalling to p38 via RIT and RIN; TRKAactivation by NGF; p75NTR negatively regulates cell cycle via SC1; p75NTR regulatesaxonogenesis; p75NTR signals via NF-kB
Function: growth factoractivity; nerve growth factor receptor binding; receptor signaling proteinactivity; signal transducer activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.