"NGF" Related Products

Expand
Expand

Recombinant Human Nerve Growth Factor (beta polypeptide)

Cat. No.: NGF-1869H
Product Overview: Recombinant human NGFis a non-glycosylated, polypeptide chain containing 222 amino acids and has aMW = 49.8 kDa.
Description: NGF is critical forthe survival and maintenance of sympathetic and sensory nuerons and may playan important role in the regulation of the immune system . Nerve growthfactor (NGF) is a small secreted protein that is important for the growth,maintenance, and survival of certain target neurons (nerve cells). It alsofunctions as a signaling molecule.
Source: E. coli
Species: Human
Form: Liquid in a sterilefiltered buffer of 50 mM sodium phosphate, pH 7.2 + 150 mM sodium chloride.
MolecularWeight: 49.8 kDa
Purity: > 98% as determinedby RP-HPLC and SDS-PAGE.
Endotoxin Level: < 0.1 ng/µg ofthe protein.
Biological Activity: Determined by itsstimulation of the proliferation of TF1 cells (TF1 cell assay). The EC50 of130 ± 30 pM.
Sequence: MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAR
Storage: Centrifuge vialprior to opening Although stable for three weeks at ambient temperature,product should be stored at 2-4°C. For long term storage, it is recommendedto add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.
OfficialSymbol: NGF
Gene Name: NGF nerve growth factor (betapolypeptide) [ Homo sapiens ]
Synonyms: NGF; nerve growthfactor (beta polypeptide); NGFB; HSAN5; Beta-NGF; MGC161426; MGC161428;beta-nerve growth factor; OTTHUMP00000013653; nerve growth factor, betasubunit
Gene ID: 4803
mRNA Refseq: NM_002506
Protein Refseq: NP_002497
MIM: 162030
UniProt ID: P01138
Chromosome Location: 1p13.1
Pathway: ARMS-mediatedactivation; Cell death signalling via NRAGE; Frs2-mediated activation; MAPKsignaling pathway; NADE modulates death signalling; NRAGE signals deaththrough JNK; PLC-gamma1 signalling; Retrograde neurotrophin signalling;Retrograde neurotrophin signalling; Signalling to p38 via RIT and RIN; TRKAactivation by NGF; p75NTR negatively regulates cell cycle via SC1; p75NTR regulatesaxonogenesis; p75NTR signals via NF-kB
Function: growth factoractivity; nerve growth factor receptor binding; receptor signaling proteinactivity; signal transducer activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.