Recombinant Human NGF Protein

Cat.No. : NGF-124H
Product Overview : Recombinant Human beta-Nerve Growth Factor is produced by our Mammalian expression system and the target gene encoding Ser122-Arg239 is expressed.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Protein Length : Ser122-Arg239
Description : Human β-Nerve Growth Factor (β-NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits α, β, and γ; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. Β-NGF is a neurotrophic factor that signals through its receptor β-NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. Β-NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that β-NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human β-NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.
Form : Lyophilized from a 0.2 um filtered solution of 20mM PB, 250mM NaCl, pH 7.0.
AA Sequence : SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGC RGIDSKHWNSYCTTT HTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
Endotoxin : Less than 0.1 ng/ug (1 EU/ug).
Purity : >90%
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100μg/ml.
Dissolve the lyophilized protein in distilled water.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Quality Statement : Purity: Greater than 90% as determined by reducing SDS-PAGE.
Shipping : The product is shipped at ambient temperature.
Upon receipt, store it immediately at the temperature listed below.
Gene Name NGF nerve growth factor [ Homo sapiens (human) ]
Official Symbol NGF
Synonyms Beta-Nerve Growth Factor; Beta-NGF; NGFB; HSAN5
Gene ID 4803
mRNA Refseq NM_002506.3
Protein Refseq NP_002497.2
MIM 162030
UniProt ID P01138

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NGF Products

Required fields are marked with *

My Review for All NGF Products

Required fields are marked with *

0
cart-icon