Recombinant Human NGF Protein

• Cat.No.: NGF-124H
• Product Overview: Recombinant Human beta-Nerve Growth Factor is produced by our Mammalian expression system and the target gene encoding Ser122-Arg239 is expressed.

Specification

• Species: Human
• Source: Human Cells
• Protein Length: Ser122-Arg239
• Description: Human β-Nerve Growth Factor (β-NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits α, β, and γ; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. Β-NGF is a neurotrophic factor that signals through its receptor β-NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. Β-NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that β-NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human β-NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.
• Form: Lyophilized from a 0.2 um filtered solution of 20mM PB, 250mM NaCl, pH 7.0.
• AA Sequence: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGC RGIDSKHWNSYCTTT HTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >90%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration less than 100μg/ml.
  Dissolve the lyophilized protein in distilled water.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Quality Statement: Purity: Greater than 90% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: NGF nerve growth factor [ Homo sapiens (human) ]
• Official Symbol: NGF
• Synonyms: Beta-Nerve Growth Factor; Beta-NGF; NGFB; HSAN5
• Gene ID: 4803
• mRNA Refseq: NM_002506.3
• Protein Refseq: NP_002497.2
• MIM: 162030
• UniProt ID: P01138