"TGFB2" Related Products

Expand

Recombinant Human TGFB2

Cat. No. : TGFB2-540H
Product Overview : A 27.08 KDa recombinant protein composed of two identical 118 amino acid peptide chains linked by a single disulfide bond, produced by transient expression in non-transgenic plants (Nicotiana benthamiana), and have a 6-His-tag at the N-terminal end.
Description : Transforming growth factor-beta 2 (TGF-μ2) is a secreted protein known as a cytokine that performs many cellular functions and has a vital role during embryonic development (alternative names: Glioblastoma-derived T-cell suppressor factor, G-TSF, BSC-1 cell growth inhibitor, Polyergin, Cetermin). It is an extracellular glycosylated protein. It is known to suppress the effects of interleukin dependent T-cell tumors. There are two named isoforms of this protein, created by alternative splicing of the same gene.
Sequence : HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Theoretical MW (kDa) : 27.08
Form : Lyophilized
Preparation Method : Non-transgenic plants (Nicotiana benthamiana) expression system
Purity : > 97% by SDS-PAGE
Endotoxin Level : μ 0.04 EU/ug protein
Activity : The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation.
Application : SDS-PAGE; Western Blot (Recombinant protein)
Storage Buffer : Lyophilized from 0.05 M Tris-HCl, pH 7.4.
Storage : Store at 4°C on dry atmosphere.
Unitprot ID : P61812
Pathways : Cell cycle; Chronic myeloid leukemia; Cytokine-cytokine receptor interaction; Dilated cardiomyopathy; Hypertrophic cardiomyopathy (HCM); MAPK signaling pathway; Pathways in cancer; Renal cell carcinoma; TGF-beta signaling pathway; Hemostasis
Gene Name : TGFB2 transforming growth factor, beta 2 [ Homo sapiens ]
Official Symbol : TGFB2
Synonyms : TGFB2; Transforming growth factor beta 2; MGC116892; TGF-beta2; Transforming growth factor beta-2; TGF-beta-2; Glioblastoma-derived T-cell suppressor factor; G-TSF; BSC-1 cell growth inhibitor; Polyergin; Cetermin
Gene ID : 7042
mRNA Refseq : NM_001135599
Protein Refseq : NP_001129071
MIM : 190220
Chromosome Location : 1q41
Function : beta-amyloid binding; cytokine activity; protein heterodimerization activity; growth factor activity; type II transforming growth factor beta receptor binding; receptor signaling protein serine/threonine kinase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.