Recombinant Human F8, GST-tagged
Cat.No. : | F8-126H |
Product Overview : | Recombinant Human F8 (1 a.a. - 216 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes coagulation factor VIII, which participates in the intrinsic pathway of blood coagulation; factor VIII is a cofactor for factor IXa which, in the presence of Ca+2 and phospholipids, converts factor X to the activated form Xa. This gene produces two alternatively spliced transcripts. Transcript variant 1 encodes a large glycoprotein, isoform a, which circulates in plasma and associates with von Willebrand factor in a noncovalent complex. This protein undergoes multiple cleavage events. Transcript variant 2 encodes a putative small protein, isoform b, which consists primarily of the phospholipid binding domain of factor VIIIc. This binding domain is essential for coagulant activity. Defects in this gene results in hemophilia A, a common recessive X-linked coagulation disorder. |
Molecular Mass : | 51 kDa |
Sequence : | MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY |
Purification : | Glutathione Sepharose 4 Fast Flow |
Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Note : | Best use within three months from the date of receipt of this protein. |
OfficialSymbol : | F8 |
Gene Name | F8 coagulation factor VIII, procoagulant component [ Homo sapiens ] |
Synonyms | F8; coagulation factor VIII, procoagulant component; AHF; F8B; F8C; HEMA; FVIII; DXS1253E; Factor VIIIF8B; hemophilia A; Antihemophilic factor; Procoagulant component; coagulation factor VIII; coagulation factor VIIIc; coagulation factor VIII; OTTHUMP00000061446; OTTHUMP00000196174; Coagulation factor VIII; Factor VIIIa heavy chain, 200 kDa isoform; Factor VIIIa heavy chain, 92 kDa isoform; Factor VIII B chain; Factor VIIIa light chain |
Gene ID | 2157 |
mRNA Refseq | NM_019863 |
Protein Refseq | NP_063916 |
MIM | 300841 |
UniProt ID | P00451 |
Chromosome Location | Xq28 |
Pathway | Complement and coagulation cascades; Hemostasis |
Function | copper ion binding; oxidoreductase activity; protein binding |
◆ Recombinant Proteins | ||
F8-1921M | Recombinant Mouse F8 protein, His-tagged | +Inquiry |
F8-912C | Recombinant Cattle F8 Protein, His-tagged | +Inquiry |
F8-2397H | Recombinant Human Coagulation Factor VIII, Procoagulant Component | +Inquiry |
F8-12626H | Recombinant Human F8, His-tagged | +Inquiry |
F8-3309R | Recombinant Rat F8 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
F8-6482HCL | Recombinant Human F8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F8 Products
Required fields are marked with *
My Review for All F8 Products
Required fields are marked with *