Recombinant Human F8, GST-tagged

Cat.No. : F8-126H
Product Overview : Recombinant Human F8 (1 a.a. - 216 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes coagulation factor VIII, which participates in the intrinsic pathway of blood coagulation; factor VIII is a cofactor for factor IXa which, in the presence of Ca+2 and phospholipids, converts factor X to the activated form Xa. This gene produces two alternatively spliced transcripts. Transcript variant 1 encodes a large glycoprotein, isoform a, which circulates in plasma and associates with von Willebrand factor in a noncovalent complex. This protein undergoes multiple cleavage events. Transcript variant 2 encodes a putative small protein, isoform b, which consists primarily of the phospholipid binding domain of factor VIIIc. This binding domain is essential for coagulant activity. Defects in this gene results in hemophilia A, a common recessive X-linked coagulation disorder.
Molecular Mass : 51 kDa
Sequence : MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY
Purification : Glutathione Sepharose 4 Fast Flow
Storage buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note : Best use within three months from the date of receipt of this protein.
OfficialSymbol : F8
Gene Name F8 coagulation factor VIII, procoagulant component [ Homo sapiens ]
Synonyms F8; coagulation factor VIII, procoagulant component; AHF; F8B; F8C; HEMA; FVIII; DXS1253E; Factor VIIIF8B; hemophilia A; Antihemophilic factor; Procoagulant component; coagulation factor VIII; coagulation factor VIIIc; coagulation factor VIII; OTTHUMP00000061446; OTTHUMP00000196174; Coagulation factor VIII; Factor VIIIa heavy chain, 200 kDa isoform; Factor VIIIa heavy chain, 92 kDa isoform; Factor VIII B chain; Factor VIIIa light chain
Gene ID 2157
mRNA Refseq NM_019863
Protein Refseq NP_063916
MIM 300841
UniProt ID P00451
Chromosome Location Xq28
Pathway Complement and coagulation cascades; Hemostasis
Function copper ion binding; oxidoreductase activity; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All F8 Products

Required fields are marked with *

My Review for All F8 Products

Required fields are marked with *

0
cart-icon