"GATA1" Related Products

Expand
Expand

Recombinant Human GATA1, GST-tagged

Cat.No.: GATA1-2052H
Product Overview: Recombinant Human GATA1(1 a.a. - 413 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 69.2 kDa
AA Sequence: MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVF QVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGP ALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLC NACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD GIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHLYQGLGPVVLSGP VSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: GATA1 GATA binding protein 1 (globin transcription factor 1) [ Homo sapiens (human) ]
Official Symbol: GATA1
Synonyms: GATA1; GATA binding protein 1 (globin transcription factor 1); GATA binding protein 1 (globin transcription factor 1) , GF1; erythroid transcription factor; ERYF1; GATA 1; NFE1
Gene ID: 2623
mRNA Refseq: NM_002049
Protein Refseq: NP_002040
MIM: 305371
UniProt ID: P15976
Chromosome Location: Xp11.23
Pathway: C-MYB transcription factor network; Factors involved in megakaryocyte development and platelet production; Notch-mediated HES/HEY network
Function: C2H2 zinc finger domain binding; DNA binding, bending; RNA polymerase II core promoter proximal region sequence-specific DNA binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.