Recombinant Full Length Human GATA1 Protein, GST-tagged
| Cat.No. : | GATA1-6938HF |
| Product Overview : | Recombinant Human full-length GATA1(1 a.a. - 413 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 413 amino acids |
| Description : | This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia. |
| Molecular Mass : | 69.2 kDa |
| AA Sequence : | MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVF QVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGP ALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLC NACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD GIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHLYQGLGPVVLSGP VSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GATA1 GATA binding protein 1 (globin transcription factor 1) [ Homo sapiens (human) ] |
| Official Symbol | GATA1 |
| Synonyms | GATA1; GATA binding protein 1 (globin transcription factor 1); GATA binding protein 1 (globin transcription factor 1) , GF1; erythroid transcription factor; ERYF1; GATA 1; NFE1 |
| Gene ID | 2623 |
| mRNA Refseq | NM_002049 |
| Protein Refseq | NP_002040 |
| MIM | 305371 |
| UniProt ID | P15976 |
| ◆ Recombinant Proteins | ||
| GATA1-2052H | Recombinant Human GATA1, GST-tagged | +Inquiry |
| GATA1-1962HFL | Recombinant Full Length Human GATA1 Protein, N-His-tagged | +Inquiry |
| Gata1-475R | Recombinant Rat Gata1 Protein, His-tagged | +Inquiry |
| GATA1-28476TH | Recombinant Human GATA1, His-tagged | +Inquiry |
| GATA1-7013C | Recombinant Chicken GATA1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GATA1-689HCL | Recombinant Human GATA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GATA1 Products
Required fields are marked with *
My Review for All GATA1 Products
Required fields are marked with *
