Recombinant Human PLAT therapeutic protein PLAT-P005H

Recombinant Human PLAT therapeutic protein

PRODUCTS

Home / Products / Recombinant Human PLAT therapeutic protein

Recombinant Human PLAT therapeutic protein

PLAT Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : PLAT-P005H
Product Overview : Human tissue plasminogen activator, purified, glycosylated, 527 residues purified from CHO cells.
Description : This gene encodes tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding; decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. The expression product is the active ingredient of Activase.
Source : CHO
Species : Human
Molecular Mass : 59KDa
Protein length : 527 Aa
AA Sequence : SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDF VCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHN YCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKV YTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADI ASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVE KYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSP FYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLV GIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name : PLAT plasminogen activator, tissue [ Homo sapiens ]
Official Symbol : PLAT
Synonyms : PLAT; plasminogen activator, tissue; tissue-type plasminogen activator; alteplase; reteplase; t-plasminogen activator; plasminogen activator, tissue type; tissue plasminogen activator (t-PA); TPA; T-PA; DKFZp686I03148;
Gene ID : 5327
mRNA Refseq : NM_000930
Protein Refseq : NP_000921
MIM : 173370
UniProt ID : P00750
Chromosome Location : 8p11.21
Pathway : Blood Clotting Cascade, organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Dissolution of Fibrin Clot, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Hemostasis, organism-specific biosystem;
Function : peptidase activity; protein binding; serine-type endopeptidase activity; serine-type endopeptidase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy