"ATG7" Related Products

Expand
Expand

Recombinant Human full-length ATG7, GST-tagged

Cat.No.: ATG7-127H
Product Overview: Recombinant Human full-length ATG7(1 a.a. - 703 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene was identified based on homology to Pichia pastoris GSA7 and Saccharomyces cerevisiae APG7. In the yeast, the protein appears to be required for fusion of peroxisomal and vacuolar membranes. The protein shows homology to the ATP-binding and catalytic sites of the E1 ubiquitin activating enzymes.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 104.4 kDa
AA Sequence: MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAP TPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCY PALCLPESLPLIQGPVGLDQRFSLKQIEALECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRT KITIGVYDPCNLAQYPGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPK AVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLM GWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADRLQKIFPGVNARGFNMSIPMPGHPVNFSSVT LEQARRDVEQLEQLIESHDVVFLLMDTRESRWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCP NHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEG GYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSF LEDLTGLTLLHQETQAAEIWDMSDDETI
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: ATG7 autophagy related 7 [ Homo sapiens (human) ]
Official Symbol: ATG7
Synonyms: ATG7; ATG7 autophagy related 7 homolog (S. cerevisiae); APG7 autophagy 7 like (S. cerevisiae) , APG7L; ubiquitin-like modifier-activating enzyme ATG7; DKFZp434N0735; GSA7; hAGP7; autophagy-related protein 7; ATG12-activating enzyme E1 ATG7; ubiquitin activating enzyme E1-like protein; ubiquitin-activating enzyme E1-like protein; APG7L; APG7-LIKE
Gene ID: 10533
mRNA Refseq: NM_006395
Protein Refseq: NP_006386
MIM: 608760
UniProt ID: O95352
Chromosome Location: 3p25.3
Pathway: Adaptive Immune System; Antigen processing: Ubiquitination & Proteasome degradation; Class I MHC mediated antigen processing & presentation
Function: Atg12 activating enzyme activity; Atg8 activating enzyme activity; protein binding; protein homodimerization activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.