Recombinant Human APG7L protein, GST-tagged

Cat.No. : APG7L-680H
Product Overview : Human APG7L partial ORF ( NP_006386, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
Molecular Mass : 36.74 kDa
AA Sequence : MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATG7 ATG7 autophagy related 7 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol ATG7
Synonyms ATG7; ATG7 autophagy related 7 homolog (S. cerevisiae); APG7 autophagy 7 like (S. cerevisiae) , APG7L; ubiquitin-like modifier-activating enzyme ATG7; DKFZp434N0735; GSA7; hAGP7; autophagy-related protein 7; ATG12-activating enzyme E1 ATG7; ubiquitin activating enzyme E1-like protein; ubiquitin-activating enzyme E1-like protein; APG7L; APG7-LIKE;
Gene ID 10533
mRNA Refseq NM_001136031
Protein Refseq NP_001129503
MIM 608760
UniProt ID O95352

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATG7 Products

Required fields are marked with *

My Review for All ATG7 Products

Required fields are marked with *

0
cart-icon
0
compare icon