Recombinant Mouse Mmp12 protein, His-tagged Mmp12-533M

Recombinant Mouse Mmp12 protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Mmp12 protein, His-tagged

Recombinant Mouse Mmp12 protein, His-tagged

Mmp12 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Mmp12-533M
Product Overview : Recombinant Mouse Mmp12 (Ala29-Cys473), fussed with His tag at C-terminal, was expressed in Human Cells.
Source : Human Cells
Species : Mouse
Tag : His
Form : Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4
Protein length : Ala29-Cys473
AA Sequence : APMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQH LRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYF DGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFR LSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSI WPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKH YWRYDVRQELMDPAYPKLISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGCVDHHH HHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Shipping : The product is shipped on dry ice/ice packs.
Gene Name : Mmp12 matrix metallopeptidase 12 [ Mus musculus ]
Official Symbol : Mmp12
Synonyms : MMP12; matrix metallopeptidase 12; macrophage metalloelastase; MME; MMP-12; macrophage elastase; macrophage-metalloelastase; matrix metalloproteinase 12; matrix metalloproteinase-12; Mmel; AV378681;
Gene ID : 17381
mRNA Refseq : NM_008605
Protein Refseq : NP_032631
UniProt ID : P34960
Chromosome Location : 9 A1; 9 2.46 Cm
Pathway : Matrix Metalloproteinases, organism-specific biosystem;
Function : calcium ion binding; hydrolase activity; metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; zinc ion binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy