Recombinant Human ADCYAP1R1

Cat.No. : ADCYAP1R1-28657TH
Product Overview : Recombinant fragment corresponding to amino acids 21-120 of Human PACAP receptor with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Most abundant in the brain, low expression in the lung, liver, thymus, spleen, pancreas and placenta.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
Sequence Similarities : Belongs to the G-protein coupled receptor 2 family.
Gene Name ADCYAP1R1 adenylate cyclase activating polypeptide 1 (pituitary) receptor type I [ Homo sapiens ]
Official Symbol ADCYAP1R1
Synonyms ADCYAP1R1; adenylate cyclase activating polypeptide 1 (pituitary) receptor type I; pituitary adenylate cyclase-activating polypeptide type I receptor; PAC1; PAC1R; PACAP receptor 1; PACAPR;
Gene ID 117
mRNA Refseq NM_001118
Protein Refseq NP_001109
MIM 102981
Uniprot ID P41586
Chromosome Location 7
Pathway Activation of TRKA receptors, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem;
Function ADP-ribosylation factor binding; adenylate cyclase binding; neuropeptide binding; pituitary adenylate cyclase-activating polypeptide receptor activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADCYAP1R1 Products

Required fields are marked with *

My Review for All ADCYAP1R1 Products

Required fields are marked with *

0
cart-icon