Recombinant Human ADCYAP1R1

PRODUCTS

Home / Products / Antibody / Recombinant Human ADCYAP1R1

Recombinant Human ADCYAP1R1

ADCYAP1R1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ADCYAP1R1-28657TH
Product Overview : Recombinant fragment corresponding to amino acids 21-120 of Human PACAP receptor with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description : This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified.
Protein length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Most abundant in the brain, low expression in the lung, liver, thymus, spleen, pancreas and placenta.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
Sequence Similarities : Belongs to the G-protein coupled receptor 2 family.
Gene Name : ADCYAP1R1 adenylate cyclase activating polypeptide 1 (pituitary) receptor type I [ Homo sapiens ]
Official Symbol : ADCYAP1R1
Synonyms : ADCYAP1R1; adenylate cyclase activating polypeptide 1 (pituitary) receptor type I; pituitary adenylate cyclase-activating polypeptide type I receptor; PAC1; PAC1R; PACAP receptor 1; PACAPR;
Gene ID : 117
mRNA Refseq : NM_001118
Protein Refseq : NP_001109
MIM : 102981
Uniprot ID : P41586
Chromosome Location : 7
Pathway : Activation of TRKA receptors, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem;
Function : ADP-ribosylation factor binding; adenylate cyclase binding; neuropeptide binding; pituitary adenylate cyclase-activating polypeptide receptor activity; receptor activity;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.