Recombinant Human ADCYAP1R1 Protein, GST-tagged

Cat.No. : ADCYAP1R1-335H
Product Overview : Human ADCYAP1R1 partial ORF ( NP_001109, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Dec 2010]
Molecular Mass : 36.74 kDa
AA Sequence : MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADCYAP1R1 adenylate cyclase activating polypeptide 1 (pituitary) receptor type I [ Homo sapiens ]
Official Symbol ADCYAP1R1
Synonyms ADCYAP1R1; adenylate cyclase activating polypeptide 1 (pituitary) receptor type I; pituitary adenylate cyclase-activating polypeptide type I receptor; PAC1; PAC1R; PACAP receptor 1; PACAPR; PACAP-R1; PACAP type I receptor; pituitary adenylate cyclase activating polypeptide 1 receptor type I Hiphop; PACAPRI;
Gene ID 117
mRNA Refseq NM_001118
Protein Refseq NP_001109
MIM 102981
UniProt ID P41586

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADCYAP1R1 Products

Required fields are marked with *

My Review for All ADCYAP1R1 Products

Required fields are marked with *

0
cart-icon