Recombinant Human AKR1C2

PRODUCTS

Home / Products / Antibody / Recombinant Human AKR1C2

Recombinant Human AKR1C2

AKR1C2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : AKR1C2-27158TH
Product Overview : Recombinant full length Human AKR1C2 with N terminal proprietary tag, MW: 61.53 kDa inclusive of tag. P52895, AAH07024.
Description : This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
Protein length : 323 amino acids
Molecular Weight : 61.530kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKL AIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIF YTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV SVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLA KSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQR KLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN VQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFS DEY
Sequence Similarities : Belongs to the aldo/keto reductase family.
Gene Name : AKR1C2 aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) [ Homo sapiens ]
Official Symbol : AKR1C2
Synonyms : AKR1C2; aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III); DDH2; aldo-keto reductase family 1 member C2; BABP; DD; DD2; HAKRD; MCDR2;
Gene ID : 1646
mRNA Refseq : NM_001135241
Protein Refseq : NP_001128713
MIM : 600450
Uniprot ID : P52895
Chromosome Location : 10p15-p14
Pathway : Metabolism of xenobiotics by cytochrome P450, organism-specific biosystem; Metabolism of xenobiotics by cytochrome P450, conserved biosystem; Steroid hormone biosynthesis, organism-specific biosystem; Steroid hormone biosynthesis, conserved biosystem;
Function : androsterone dehydrogenase (A-specific) activity; bile acid binding; carboxylic acid binding; oxidoreductase activity; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.