Recombinant Human AKR1C2
| Cat.No. : | AKR1C2-27159TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 224-323 of Human AKR1C2, with N terminal proprietary tag; predicted MW: 36.63 kDa inclusive of tag. AAH63574. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | EEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY |
| Sequence Similarities : | Belongs to the aldo/keto reductase family. |
| Gene Name | AKR1C2 aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) [ Homo sapiens ] |
| Official Symbol | AKR1C2 |
| Synonyms | AKR1C2; aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III); DDH2; aldo-keto reductase family 1 member C2; BABP; DD; DD2; HAKRD; MCDR2; |
| Gene ID | 1646 |
| mRNA Refseq | NM_001135241 |
| Protein Refseq | NP_001128713 |
| MIM | 600450 |
| Uniprot ID | P52895 |
| Chromosome Location | 10p15-p14 |
| Pathway | Metabolism of xenobiotics by cytochrome P450, organism-specific biosystem; Metabolism of xenobiotics by cytochrome P450, conserved biosystem; Steroid hormone biosynthesis, organism-specific biosystem; Steroid hormone biosynthesis, conserved biosystem; |
| Function | androsterone dehydrogenase (A-specific) activity; bile acid binding; carboxylic acid binding; oxidoreductase activity; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity; |
| ◆ Recombinant Proteins | ||
| AKR1C2-898H | Recombinant Human AKR1C2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AKR1C2-01H | Recombinant Human AKR1C2 Protein, DYKDDDDK-tagged | +Inquiry |
| AKR1C2-2895HFL | Recombinant Full Length Human AKR1C2, Flag-tagged | +Inquiry |
| AKR1C2-27159TH | Recombinant Human AKR1C2 | +Inquiry |
| AKR1C2-16HF | Recombinant Full Length Human AKR1C2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AKR1C2-8930HCL | Recombinant Human AKR1C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKR1C2 Products
Required fields are marked with *
My Review for All AKR1C2 Products
Required fields are marked with *



