"BIRC2" Related Products

Expand
Expand
Expand

Recombinant Human BIRC2

Cat.No.: BIRC2-27192TH
Product Overview: Recombinant full length Human cIAP1 with an N terminal proprietary tag; predicted mwt: 94.05 kDa inclusive of tag.
Description: The protein encoded by this gene is a member of a family of proteins that inhibits apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. This encoded protein inhibits apoptosis induced by serum deprivation and menadione, a potent inducer of free radicals.
Protein length: 618 amino acids
Molecular Weight: 94.050kDa
Source: Wheat germ
Tissue specificity: Present in many fetal and adult tissues. Mainly expressed in adult skeletal muscle, thymus, testis, ovary, and pancreas, low or absent in brain and peripheral blood leukocytes.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMK YDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDK VKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNP LNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLS PSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWP SSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGD DPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSAL EMGFNRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDE KREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAA ANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEE QLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR KCPICRGIIKGTVRTFLS
Sequence Similarities: Belongs to the IAP family.Contains 3 BIR repeats.Contains 1 CARD domain.Contains 1 RING-type zinc finger.
Gene Name: BIRC2 baculoviral IAP repeat containing 2 [ Homo sapiens ]
Official Symbol: BIRC2
Synonyms: BIRC2; baculoviral IAP repeat containing 2; API1, baculoviral IAP repeat containing 2; baculoviral IAP repeat-containing protein 2; apoptosis inhibitor 1; c IAP1; cIAP1; hiap 2; MIHB; NFR2 TRAF signalling complex protein; RNF48;
Gene ID: 329
mRNA Refseq: NM_001166
Protein Refseq: NP_001157
MIM: 601712
Uniprot ID: Q13490
Chromosome Location: 11q22
Pathway: Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem;
Function: metal ion binding; protein N-terminus binding; protein binding; ubiquitin-protein ligase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.