"CD7" Related Products

Expand
Expand

Recombinant Human CD7

Cat.No.: CD7-27506TH
Product Overview: Recombinant full length mature Human CD7 with a N terminal proprietary tag; Predicted MWt 50.31 kDa.
Description: This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.
Protein length: 220 amino acids
Molecular Weight: 50.310kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLR QLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTIT MHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWH RCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP AALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACV VYEDMSHSRCNTLSSPNQYQ
Sequence Similarities: Contains 1 Ig-like (immunoglobulin-like) domain.
Gene Name: CD7 CD7 molecule [ Homo sapiens ]
Official Symbol: CD7
Synonyms: CD7; CD7 molecule; CD7 antigen (p41); T-cell antigen CD7; GP40; LEU 9; p41 protein; T cell antigen CD7; T cell leukemia antigen; Tp40; TP41;
Gene ID: 924
mRNA Refseq: NM_006137
Protein Refseq: NP_006128
MIM: 186820
Uniprot ID: P09564
Chromosome Location: 17q25.2-q25.3
Pathway: Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem;
Function: receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.