Recombinant Human CD7
Cat.No. : | CD7-27506TH |
Product Overview : | Recombinant full length mature Human CD7 with a N terminal proprietary tag; Predicted MWt 50.31 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. |
Protein length : | 220 amino acids |
Molecular Weight : | 50.310kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLR QLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTIT MHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWH RCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP AALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACV VYEDMSHSRCNTLSSPNQYQ |
Sequence Similarities : | Contains 1 Ig-like (immunoglobulin-like) domain. |
Gene Name : | CD7 CD7 molecule [ Homo sapiens ] |
Official Symbol : | CD7 |
Synonyms : | CD7; CD7 molecule; CD7 antigen (p41); T-cell antigen CD7; GP40; LEU 9; p41 protein; T cell antigen CD7; T cell leukemia antigen; Tp40; TP41; |
Gene ID : | 924 |
mRNA Refseq : | NM_006137 |
Protein Refseq : | NP_006128 |
MIM : | 186820 |
Uniprot ID : | P09564 |
Chromosome Location : | 17q25.2-q25.3 |
Pathway : | Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
Function : | receptor activity; |
Products Types
◆ Recombinant Protein | ||
Cd7-8761R | Recombinant Rat Cd7 protein(Met1-Pro149), hFc-tagged | +Inquiry |
CD7-696H | Recombinant Human CD7 Protein, His-tagged | +Inquiry |
CD7-0847H | Recombinant Human CD7 Protein, GST-Tagged | +Inquiry |
CD7-697H | Recombinant Human CD7 Protein, His-tagged | +Inquiry |
CD7-0832H | Recombinant Human CD7 Protein | +Inquiry |
◆ Lysates | ||
CD7-2607HCL | Recombinant Human CD7 cell lysate | +Inquiry |
CD7-2518MCL | Recombinant Mouse CD7 cell lysate | +Inquiry |
CD7-1368RCL | Recombinant Rat CD7 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All CD7 Products
Required fields are marked with *
My Review for All CD7 Products
Required fields are marked with *
0
Inquiry Basket