"CD7" Related Products

Expand
Expand

Recombinant Human CD7 Protein

Cat.No. : CD7-0832H
Product Overview : Human CD7 full-length ORF (NP_006128.1) recombinant protein without tag was expressed in wheat germ.
Description : This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.
Source : Wheat Germ
Species : Human
Form : Liquid
Molecular Mass : 25.4 kDa
AA Sequence : MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name : CD7 CD7 molecule [ Homo sapiens (human) ]
Official Symbol : CD7
Synonyms : CD7; CD7 molecule; GP40; TP41; Tp40; LEU-9; T-cell antigen CD7; CD7 antigen (p41); T-cell leukemia antigen; T-cell surface antigen Leu-9; p41 protein
Gene ID : 924
mRNA Refseq : NM_006137
Protein Refseq : NP_006128
MIM : 186820
UniProt ID : P09564

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.