Recombinant Human CD7 protein, His-SUMO-tagged

Cat.No. : CD7-2671H
Product Overview : Recombinant Human CD7 protein(P09564)(26-180aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 26-180aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 32.4 kDa
AA Sequence : AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CD7 CD7 molecule [ Homo sapiens ]
Official Symbol CD7
Synonyms CD7; CD7 molecule; CD7 antigen (p41); T-cell antigen CD7; GP40; LEU 9; p41 protein; T cell antigen CD7; T cell leukemia antigen; Tp40; TP41; T-cell leukemia antigen; T-cell surface antigen Leu-9; LEU-9;
Gene ID 924
mRNA Refseq NM_006137
Protein Refseq NP_006128
MIM 186820
UniProt ID P09564

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD7 Products

Required fields are marked with *

My Review for All CD7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon