"CDH10" Related Products

Recombinant Human CDH10, His-tagged

Cat.No.: CDH10-26741TH
Product Overview: Recombinant fragment, corresponding to amino acids 228-514 of Human cadherin 10 with N terminal His tag; MWt 33kDa.
Description: This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. The extracellular domain consists of 5 subdomains, each containing a cadherin motif, and appears to determine the specificity of the proteins homophilic cell adhesion activity. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin is predominantly expressed in brain and is putatively involved in synaptic adhesions, axon outgrowth and guidance.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 147 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNDNPP RFPQNTIHLRVLESSPVGTAIGSVKATDADTGKNAEVE YRIIDGDGTDMFDIVTEKDTQEGIITVKKPLDYESRRL YTLKVEAENTHVDPRFYYLGPFKDTTIVKISIEDVDEP PVFSRSSYLFEVHEDIEVGTIIGTVMARDPDSISSPIRFS LDRHTDLDRIFNIHSGNGSLYTSKPLDRELSQWHNLTV IAAEINNPKETTRVAVFVRILDVNDNAPQFAVFYDTFV CENARPGQLIQTISAVD
Gene Name: CDH10 cadherin 10, type 2 (T2-cadherin) [ Homo sapiens ]
Official Symbol: CDH10
Synonyms: CDH10; cadherin 10, type 2 (T2-cadherin); cadherin-10;
Gene ID: 1008
mRNA Refseq: NM_006727
Protein Refseq: NP_006718
MIM: 604555
Uniprot ID: Q9Y6N8
Chromosome Location: 5p14.2
Pathway: Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function: calcium ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.