Recombinant Human CDH10, His-tagged
Cat.No. : | CDH10-26741TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 228-514 of Human cadherin 10 with N terminal His tag; MWt 33kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 228-514 a.a. |
Description : | This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. The extracellular domain consists of 5 subdomains, each containing a cadherin motif, and appears to determine the specificity of the proteins homophilic cell adhesion activity. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin is predominantly expressed in brain and is putatively involved in synaptic adhesions, axon outgrowth and guidance. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 147 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNDNPP RFPQNTIHLRVLESSPVGTAIGSVKATDADTGKNAEVE YRIIDGDGTDMFDIVTEKDTQEGIITVKKPLDYESRRL YTLKVEAENTHVDPRFYYLGPFKDTTIVKISIEDVDEP PVFSRSSYLFEVHEDIEVGTIIGTVMARDPDSISSPIRFS LDRHTDLDRIFNIHSGNGSLYTSKPLDRELSQWHNLTV IAAEINNPKETTRVAVFVRILDVNDNAPQFAVFYDTFV CENARPGQLIQTISAVD |
Gene Name | CDH10 cadherin 10, type 2 (T2-cadherin) [ Homo sapiens ] |
Official Symbol | CDH10 |
Synonyms | CDH10; cadherin 10, type 2 (T2-cadherin); cadherin-10; |
Gene ID | 1008 |
mRNA Refseq | NM_006727 |
Protein Refseq | NP_006718 |
MIM | 604555 |
Uniprot ID | Q9Y6N8 |
Chromosome Location | 5p14.2 |
Pathway | Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function | calcium ion binding; |
◆ Recombinant Proteins | ||
CDH10-1501M | Recombinant Mouse CDH10 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDH10-41H | Active Recombinant Human CDH10 protein, Fc-tagged | +Inquiry |
RFL21111GF | Recombinant Full Length Chicken Cadherin-10(Cdh10) Protein, His-Tagged | +Inquiry |
RFL31940MF | Recombinant Full Length Mouse Cadherin-10(Cdh10) Protein, His-Tagged | +Inquiry |
CDH10-26741TH | Recombinant Human CDH10, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH10 Products
Required fields are marked with *
My Review for All CDH10 Products
Required fields are marked with *
0
Inquiry Basket