Recombinant Human CDH10, His-tagged
Cat.No. : | CDH10-26741TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 228-514 of Human cadherin 10 with N terminal His tag; MWt 33kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. The extracellular domain consists of 5 subdomains, each containing a cadherin motif, and appears to determine the specificity of the proteins homophilic cell adhesion activity. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin is predominantly expressed in brain and is putatively involved in synaptic adhesions, axon outgrowth and guidance. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 147 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNDNPP RFPQNTIHLRVLESSPVGTAIGSVKATDADTGKNAEVE YRIIDGDGTDMFDIVTEKDTQEGIITVKKPLDYESRRL YTLKVEAENTHVDPRFYYLGPFKDTTIVKISIEDVDEP PVFSRSSYLFEVHEDIEVGTIIGTVMARDPDSISSPIRFS LDRHTDLDRIFNIHSGNGSLYTSKPLDRELSQWHNLTV IAAEINNPKETTRVAVFVRILDVNDNAPQFAVFYDTFV CENARPGQLIQTISAVD |
Gene Name : | CDH10 cadherin 10, type 2 (T2-cadherin) [ Homo sapiens ] |
Official Symbol : | CDH10 |
Synonyms : | CDH10; cadherin 10, type 2 (T2-cadherin); cadherin-10; |
Gene ID : | 1008 |
mRNA Refseq : | NM_006727 |
Protein Refseq : | NP_006718 |
MIM : | 604555 |
Uniprot ID : | Q9Y6N8 |
Chromosome Location : | 5p14.2 |
Pathway : | Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function : | calcium ion binding; |
Products Types
◆ Recombinant Protein | ||
CDH10-1501M | Recombinant Mouse CDH10 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDH10-41H | Active Recombinant Human CDH10 protein, Fc-tagged | +Inquiry |
CDH10-2216H | Recombinant Human CDH10 protein, His-tagged | +Inquiry |
CDH10-7144C | Recombinant Chicken CDH10 | +Inquiry |
CDH10-3163M | Recombinant Mouse CDH10 Protein | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket