Recombinant Human CYP4A11

Cat.No. : CYP4A11-26692TH
Product Overview : Recombinant full length Human Cytochrome P450 4A11/22 with N-terminal proprietary tag. Mol Wt 49.76 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 216 amino acids
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates medium-chain fatty acids such as laurate and myristate.
Molecular Weight : 49.760kDa
Tissue specificity : Kidney and liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLH RQWLLKALQQSPCPPSHWLFGHIQELQQDQELQRIQKWVE TFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSY RFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVG LMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKC AFRHWQRAQHSRHLP
Sequence Similarities : Belongs to the cytochrome P450 family.
Gene Name CYP4A11 cytochrome P450, family 4, subfamily A, polypeptide 11 [ Homo sapiens ]
Official Symbol CYP4A11
Synonyms CYP4A11; cytochrome P450, family 4, subfamily A, polypeptide 11; CYP4A2, cytochrome P450, subfamily IVA, polypeptide 11; cytochrome P450 4A11; CYP4AII;
Gene ID 1579
mRNA Refseq NM_000778
Protein Refseq NP_000769
MIM 601310
Uniprot ID Q02928
Chromosome Location 1p33
Pathway Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Biological oxidations, organism-specific biosystem; Cytochrome P450 - arranged by substrate type, organism-specific biosystem; Fatty Acid Omega Oxidation, organism-specific biosystem;
Function alkane 1-monooxygenase activity; electron carrier activity; heme binding; metal ion binding; monooxygenase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP4A11 Products

Required fields are marked with *

My Review for All CYP4A11 Products

Required fields are marked with *

0
cart-icon