Recombinant Full Length Human CYP4A11 Protein
| Cat.No. : | CYP4A11-107HF | 
| Product Overview : | Recombinant full length Human Cytochrome P450 4A11/22 with N-terminal proprietary tag. Mol Wt 49.76 kDa inclusive of tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Protein Length : | 216 amino acids | 
| Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates medium-chain fatty acids such as laurate and myristate. | 
| Form : | Liquid | 
| Molecular Mass : | 49.760kDa | 
| AA Sequence : | MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLH RQWLLKALQQSPCPPSHWLFGHIQELQQDQELQRIQKWVE TFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSY RFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVG LMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKC AFRHWQRAQHSRHLP | 
| Purity : | Proprietary Purification | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. | 
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. | 
| Gene Name | CYP4A11 cytochrome P450, family 4, subfamily A, polypeptide 11 [ Homo sapiens ] | 
| Official Symbol | CYP4A11 | 
| Synonyms | CYP4A11; cytochrome P450, family 4, subfamily A, polypeptide 11; CYP4A2, cytochrome P450, subfamily IVA, polypeptide 11; cytochrome P450 4A11; CYP4AII | 
| Gene ID | 1579 | 
| mRNA Refseq | NM_000778 | 
| Protein Refseq | NP_000769 | 
| MIM | 601310 | 
| UniProt ID | Q02928 | 
| ◆ Recombinant Proteins | ||
| CYP4A11-73H | Active Recombinant Human CYP4A11 Protein | +Inquiry | 
| CYP4A11-2440HF | Recombinant Full Length Human CYP4A11 Protein, GST-tagged | +Inquiry | 
| CYP4A11-191C | Recombinant Cynomolgus Monkey CYP4A11 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CYP4A11-445C | Recombinant Cynomolgus CYP4A11 Protein, His-tagged | +Inquiry | 
| CYP4A11-26692TH | Recombinant Human CYP4A11 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CYP4A11-439HCL | Recombinant Human CYP4A11 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP4A11 Products
Required fields are marked with *
My Review for All CYP4A11 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            