Recombinant Human DCPS, His-tagged DCPS-27368TH

Recombinant Human DCPS, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human DCPS, His-tagged

Recombinant Human DCPS, His-tagged

DCPS Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : DCPS-27368TH
Product Overview : Recombinant full-length Human DCPS (amino acids 1-337) with a N terminal His tag. 357 amino acids with a predicted MWt 40.8 kDa including tag.
Description : Scavenger mRNA-decapping enzyme DcpS is a protein that in humans is encoded by the DCPS gene.
Protein length : 337 amino acids
Conjugation : HIS
Molecular Weight : 40.800kDa inclusive of tags
Source : E. coli
Tissue specificity : Detected in liver, brain, kidney, testis and prostate.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. Mix suspension via gentle inversion before use.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMADAAPQLGKRKRELDV EEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRE SARDKIIFLHGKVNEASGDGDGEDAVVILEKTPFQVEQVA QLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVY PATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSI QWVYNILDKKAEADRIVFENPDPSDGFVLIPDLKWNQQ QLDDLYLIAICHRRGIRSLRDLTPEHLPLLRNILHQGQEA ILQRYRMKGDHLRVYLHYLPSYYHLHVHFTALGFEAPG SGVERAHLLAEVIENLECDPRHYQQRTLTFALRADDPLLK LLQEAQQS
Sequence Similarities : Belongs to the HIT family.
Gene Name : DCPS decapping enzyme, scavenger [ Homo sapiens ]
Official Symbol : DCPS
Synonyms : DCPS; decapping enzyme, scavenger; scavenger mRNA-decapping enzyme DcpS; HINT 5; HSL1; HSPC015;
Gene ID : 28960
mRNA Refseq : NM_014026
Protein Refseq : NP_054745
MIM : 610534
Uniprot ID : Q96C86
Chromosome Location : 11q24
Pathway : Deadenylation-dependent mRNA decay, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; RNA degradation, organism-specific biosystem;
Function : hydrolase activity; protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy