Recombinant Human DCPS protein(7-160 aa), GST-tagged

• Cat.No.: DCPS-11863H
• Product Overview: Recombinant Human DCPS protein(7-160 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 7-160 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: QLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASEDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRN
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: DCPS decapping enzyme, scavenger [ Homo sapiens ]
• Official Symbol: DCPS
• Synonyms: DCPS; HSL1; HINT-5; HSPC015; decapping enzyme, scavenger ; scavenger mRNA-decapping enzyme DcpS; DCS-1; OTTHUMP00000231113; mRNA decapping enzyme; heat shock-like protein 1;histidine triad protein member 5; hint-related 7meGMP-directed hydrolase; homolog of C. elegans 7meGMP-directed hydrolase dcs-1; EC 3
• Gene ID: 28960
• mRNA Refseq: NM_014026
• Protein Refseq: NP_054745
• MIM: 610534
• UniProt ID: Q96C86