"EFNA5" Related Products

Expand
Expand
Expand

Recombinant Human EFNA5

Cat.No.: EFNA5-28471TH
Product Overview: Recombinant fragment of Human Ephrin A5 with N terminal proprietary tag; predicted MWt: 35.53 kDa including the tag.
Description: Ephrin-A5, a member of the ephrin gene family, prevents axon bundling in cocultures of cortical neurons with astrocytes, a model of late stage nervous system development and differentiation. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. EPH receptors typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin ligands and receptors have been named by the Eph Nomenclature Committee (1997). Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are similarly divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
Protein length: 90 amino acids
Molecular Weight: 35.530kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: FSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
Sequence Similarities: Belongs to the ephrin family.
Gene Name: EFNA5 ephrin-A5 [ Homo sapiens ]
Official Symbol: EFNA5
Synonyms: EFNA5; ephrin-A5; EPLG7; AF1; LERK7;
Gene ID: 1946
mRNA Refseq: NM_001962
Protein Refseq: NP_001953
MIM: 601535
Uniprot ID: P52803
Chromosome Location: 5q21
Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHA forward signaling, organism-specific biosystem; EPHB forward signaling, organism-specific biosystem; Ephrin Areverse signaling, organism-specific biosystem;
Function: chemorepellent activity; ephrin receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.