Recombinant Human ETV4
Cat.No. : | ETV4-29163TH |
Product Overview : | Recombinant fragment of Human Pea3 with N terminal proprietary tag; Predicted MWt 48.88 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | ETS translocation variant 4 is a protein that in humans is encoded by the ETV4 gene. |
Protein length : | 207 amino acids |
Molecular Weight : | 48.880kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVAPEKF EGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNA HFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSR SLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQR PALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFG PKGGYSY |
Sequence Similarities : | Belongs to the ETS family.Contains 1 ETS DNA-binding domain. |
Gene Name : | ETV4 ets variant 4 [ Homo sapiens ] |
Official Symbol : | ETV4 |
Synonyms : | ETV4; ets variant 4; ets variant gene 4 (E1A enhancer binding protein, E1AF); ETS translocation variant 4; E1A enhancer binding protein; E1A F; E1AF; |
Gene ID : | 2118 |
mRNA Refseq : | NM_001079675 |
Protein Refseq : | NP_001073143 |
MIM : | 600711 |
Uniprot ID : | P43268 |
Chromosome Location : | 17q21 |
Pathway : | LKB1 signaling events, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function : | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
ETV4-3537H | Recombinant Human ETV4 Protein, GST-tagged | +Inquiry |
ETV4-8994Z | Recombinant Zebrafish ETV4 | +Inquiry |
ETV4-786H | Recombinant Human ETV4 Protein, His-tagged | +Inquiry |
ETV4-712H | Recombinant Human ETV4 Protien, GST-tagged | +Inquiry |
◆ Lysates | ||
ETV4-6522HCL | Recombinant Human ETV4 293 Cell Lysate | +Inquiry |
ETV4-6521HCL | Recombinant Human ETV4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket