"ETV4" Related Products

Expand

Recombinant Human ETV4

Cat.No.: ETV4-29163TH
Product Overview: Recombinant fragment of Human Pea3 with N terminal proprietary tag; Predicted MWt 48.88 kDa including the tag.
Description: ETS translocation variant 4 is a protein that in humans is encoded by the ETV4 gene.
Protein length: 207 amino acids
Molecular Weight: 48.880kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVAPEKF EGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNA HFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSR SLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQR PALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFG PKGGYSY
Sequence Similarities: Belongs to the ETS family.Contains 1 ETS DNA-binding domain.
Gene Name: ETV4 ets variant 4 [ Homo sapiens ]
Official Symbol: ETV4
Synonyms: ETV4; ets variant 4; ets variant gene 4 (E1A enhancer binding protein, E1AF); ETS translocation variant 4; E1A enhancer binding protein; E1A F; E1AF;
Gene ID: 2118
mRNA Refseq: NM_001079675
Protein Refseq: NP_001073143
MIM: 600711
Uniprot ID: P43268
Chromosome Location: 17q21
Pathway: LKB1 signaling events, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.