Recombinant Human ETV4
Cat.No. : | ETV4-29163TH |
Product Overview : | Recombinant fragment of Human Pea3 with N terminal proprietary tag; Predicted MWt 48.88 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 207 amino acids |
Description : | ETS translocation variant 4 is a protein that in humans is encoded by the ETV4 gene. |
Molecular Weight : | 48.880kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVAPEKF EGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNA HFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSR SLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQR PALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFG PKGGYSY |
Sequence Similarities : | Belongs to the ETS family.Contains 1 ETS DNA-binding domain. |
Gene Name | ETV4 ets variant 4 [ Homo sapiens ] |
Official Symbol | ETV4 |
Synonyms | ETV4; ets variant 4; ets variant gene 4 (E1A enhancer binding protein, E1AF); ETS translocation variant 4; E1A enhancer binding protein; E1A F; E1AF; |
Gene ID | 2118 |
mRNA Refseq | NM_001079675 |
Protein Refseq | NP_001073143 |
MIM | 600711 |
Uniprot ID | P43268 |
Chromosome Location | 17q21 |
Pathway | LKB1 signaling events, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
ETV4-3537H | Recombinant Human ETV4 Protein, GST-tagged | +Inquiry |
ETV4-786H | Recombinant Human ETV4 Protein, His-tagged | +Inquiry |
ETV4-712H | Recombinant Human ETV4 Protein, GST-tagged | +Inquiry |
ETV4-8994Z | Recombinant Zebrafish ETV4 | +Inquiry |
ETV4-4370HF | Recombinant Full Length Human ETV4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV4-6522HCL | Recombinant Human ETV4 293 Cell Lysate | +Inquiry |
ETV4-6521HCL | Recombinant Human ETV4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETV4 Products
Required fields are marked with *
My Review for All ETV4 Products
Required fields are marked with *