Recombinant Human ETV4 Protein, GST-tagged
Cat.No. : | ETV4-712H |
Product Overview : | Recombinant Human ETV4 Protien(NP_001073143)(1-207 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-207 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | ETV4 ets variant 4 [ Homo sapiens ] |
Official Symbol | ETV4 |
Synonyms | ETV4; ets variant 4; ets variant gene 4 (E1A enhancer binding protein, E1AF); ETS translocation variant 4; E1A enhancer binding protein; E1A F; E1AF; polyomavirus enhancer activator-3; adenovirus E1A enhancer-binding protein; polyomavirus enhancer activator 3 homolog; EWS protein/E1A enhancer binding protein chimera; ets variant gene 4 (E1A enhancer-binding protein, E1AF); PEA3; E1A-F; PEAS3; |
Gene ID | 2118 |
mRNA Refseq | NM_001079675 |
Protein Refseq | NP_001073143 |
MIM | 600711 |
UniProt ID | P43268 |
◆ Recombinant Proteins | ||
ETV4-4370HF | Recombinant Full Length Human ETV4 Protein, GST-tagged | +Inquiry |
ETV4-29163TH | Recombinant Human ETV4 | +Inquiry |
ETV4-786H | Recombinant Human ETV4 Protein, His-tagged | +Inquiry |
ETV4-8994Z | Recombinant Zebrafish ETV4 | +Inquiry |
ETV4-3537H | Recombinant Human ETV4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV4-6522HCL | Recombinant Human ETV4 293 Cell Lysate | +Inquiry |
ETV4-6521HCL | Recombinant Human ETV4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETV4 Products
Required fields are marked with *
My Review for All ETV4 Products
Required fields are marked with *