Recombinant Human ETV4 Protein, GST-tagged
Cat.No. : | ETV4-3537H |
Product Overview : | Human ETV4 full-length ORF ( AAH07242, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ETV4 (ETS Variant 4) is a Protein Coding gene. Diseases associated with ETV4 include Ewing Sarcoma and Extraosseous Ewing's Sarcoma. Among its related pathways are Transcriptional misregulation in cancer and CDK-mediated phosphorylation and removal of Cdc6. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II core promoter proximal region sequence-specific DNA binding. An important paralog of this gene is ETV1. |
Molecular Mass : | 48.51 kDa |
AA Sequence : | MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVAPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ETV4 ets variant 4 [ Homo sapiens ] |
Official Symbol | ETV4 |
Synonyms | ETV4; ets variant 4; ets variant gene 4 (E1A enhancer binding protein, E1AF); ETS translocation variant 4; E1A enhancer binding protein; E1A F; E1AF; polyomavirus enhancer activator-3; adenovirus E1A enhancer-binding protein; polyomavirus enhancer activator 3 homolog; EWS protein/E1A enhancer binding protein chimera; ets variant gene 4 (E1A enhancer-binding protein, E1AF); PEA3; E1A-F; PEAS3; |
Gene ID | 2118 |
mRNA Refseq | NM_001079675 |
Protein Refseq | NP_001073143 |
MIM | 600711 |
UniProt ID | P43268 |
◆ Recombinant Proteins | ||
ETV4-786H | Recombinant Human ETV4 Protein, His-tagged | +Inquiry |
ETV4-712H | Recombinant Human ETV4 Protein, GST-tagged | +Inquiry |
ETV4-3537H | Recombinant Human ETV4 Protein, GST-tagged | +Inquiry |
ETV4-4370HF | Recombinant Full Length Human ETV4 Protein, GST-tagged | +Inquiry |
ETV4-29163TH | Recombinant Human ETV4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV4-6521HCL | Recombinant Human ETV4 293 Cell Lysate | +Inquiry |
ETV4-6522HCL | Recombinant Human ETV4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ETV4 Products
Required fields are marked with *
My Review for All ETV4 Products
Required fields are marked with *
0
Inquiry Basket