Recombinant Human ETV4 Protein, GST-tagged

Cat.No. : ETV4-3537H
Product Overview : Human ETV4 full-length ORF ( AAH07242, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ETV4 (ETS Variant 4) is a Protein Coding gene. Diseases associated with ETV4 include Ewing Sarcoma and Extraosseous Ewing's Sarcoma. Among its related pathways are Transcriptional misregulation in cancer and CDK-mediated phosphorylation and removal of Cdc6. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II core promoter proximal region sequence-specific DNA binding. An important paralog of this gene is ETV1.
Molecular Mass : 48.51 kDa
AA Sequence : MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVAPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ETV4 ets variant 4 [ Homo sapiens ]
Official Symbol ETV4
Synonyms ETV4; ets variant 4; ets variant gene 4 (E1A enhancer binding protein, E1AF); ETS translocation variant 4; E1A enhancer binding protein; E1A F; E1AF; polyomavirus enhancer activator-3; adenovirus E1A enhancer-binding protein; polyomavirus enhancer activator 3 homolog; EWS protein/E1A enhancer binding protein chimera; ets variant gene 4 (E1A enhancer-binding protein, E1AF); PEA3; E1A-F; PEAS3;
Gene ID 2118
mRNA Refseq NM_001079675
Protein Refseq NP_001073143
MIM 600711
UniProt ID P43268

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ETV4 Products

Required fields are marked with *

My Review for All ETV4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon