Recombinant Human FLT3, Fc-tagged

Cat.No.: FLT3-28417TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-540 of Human Flt3 / CD135 fused to the Fc region of Human IgG1 expressed in modified Human 293 cells.
Description: This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. The receptor consists of an extracellular domain composed of five immunoglobulin-like domains, one transmembrane region, and a cytoplasmic kinase domain split into two parts by a kinase-insert domain. The receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia.
Conjugation: Fc
Tissue specificity: Bone marrow cells.
Biological activity: Activity:The ED50 of FLT3-28417TH is typically 1.0 -2.0 ng/ml as measured by its ability to neutralize Flt3 mediated proliferation of the OCI/AML5 human leukemia cell line.
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage: Store at +4°C. Aliquot and store at -20°C or -80°C when reconstituted. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: Theoretical Sequence:NQDLPVIKCVLINHKNNDSSVGKSSSYPM VSESPEDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKM TETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRP YFRKMENQDALVCISESVPEPIVEWVLCDSQGESCKEESP AVVKKEEKVLHELFGTDIRCCARNELGRECTRLFTIDL NQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELEN KALEEGNYFEMSTYSTNRTMIRILFAFVSSVARNDTGY YTCSSSKHPSQSALVTIVEKGFINATNSSEDYEIDQYEEF CFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISK FCNHKHQPGEYIFHAENDDAQFTKMFTLNIRRKPQVLA EASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITEGVW NRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLG TSCETILLNSPGPFPFIQDRIPKVDKKVEPKSCDKTHTCP PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCRVSNKALPAPIEKTISKAKGQP REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEW ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK
Sequence Similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 protein kinase domain.
Gene Name: FLT3 fms-related tyrosine kinase 3 [ Homo sapiens ]
Official Symbol: FLT3
Synonyms: FLT3; fms-related tyrosine kinase 3; receptor-type tyrosine-protein kinase FLT3; CD135; FLK2; STK1;
Gene ID: 2322
mRNA Refseq: NM_004119
Protein Refseq: NP_004110
MIM: 136351
Uniprot ID: P36888
Chromosome Location: 13q12
Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem;
Function: ATP binding; cytokine receptor activity; nucleotide binding; phosphatidylinositol 3-kinase binding; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.