Recombinant Human GM2A GM2A-27454TH

Recombinant Human GM2A

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human GM2A

Recombinant Human GM2A

GM2A Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GM2A-27454TH
Product Overview : Recombinant full length Human GM2A with N terminal proprietary tag. Predicted MW 47.3 kDa
Description : This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants.
Protein length : 193 amino acids
Molecular Weight : 47.300kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCD EGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPL KVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIP TGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELP SWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
Gene Name : GM2A GM2 ganglioside activator [ Homo sapiens ]
Official Symbol : GM2A
Synonyms : GM2A; GM2 ganglioside activator; GM2 ganglioside activator protein; ganglioside GM2 activator; cerebroside sulfate activator protein; SAP 3; sphingolipid activator protein 3;
Gene ID : 2760
mRNA Refseq : NM_000405
Protein Refseq : NP_000396
MIM : 613109
Uniprot ID : P17900
Chromosome Location : 5q33.1
Pathway : Lysosome, organism-specific biosystem; Lysosome, conserved biosystem;
Function : beta-N-acetylhexosaminidase activity; sphingolipid activator protein activity;

Products Types

◆ Recombinant Protein

GM2A-5001HRecombinant Human GM2A Protein, GST-tagged+Inquiry
GM2A-556HRecombinant Human GM2A protein, His-tagged+Inquiry
GM2A-521HRecombinant Human GM2A Protein, His-tagged+Inquiry
GM2A-27456THRecombinant Human GM2A+Inquiry
GM2A-2558ZRecombinant Zebrafish GM2A+Inquiry

See All GM2A Recombinant Protein

◆ Lysates

GM2A-450HCLRecombinant Human GM2A cell lysate+Inquiry

See All GM2A Lysates

Related Gene

GM2AGm900GM5581GM6185GM224GM98Gm885Gm949Gm221Gm6320Gm10081Gm10094Gm10096Gm101Gm10100Gm10104Gm10142Gm10147Gm10220Gm10229Gm10230Gm10267Gm10318Gm10324Gm10334Gm10345Gm10375Gm10391Gm10406Gm10436Gm11062Gm1110Gm11127Gm11128Gm1123Gm1140Gm11435Gm11437Gm11487Gm11541Gm11544Gm11545Gm11554Gm11559Gm11562Gm11563Gm11564Gm11565Gm11567Gm12253Gm12597Gm12657Gm12695Gm12789Gm12794Gm128Gm12824Gm12886Gm12887Gm12888Gm129Gm12942Gm13011Gm13023Gm13040Gm13043Gm13051Gm13242Gm13247Gm13251Gm13271Gm13272Gm13275Gm13276Gm13277Gm13278Gm13279Gm13280Gm13283Gm13285Gm13286Gm13287Gm13288Gm13289Gm13290Gm13298Gm13304Gm14308Gm14322Gm14325Gm14326Gm14345Gm14346Gm14347Gm14351Gm14374Gm14378Gm14391Gm14393Gm14420Gm14430Gm14431Gm14434Gm14436Gm14440Gm14685Gm14692Gm14725Gm14743Gm14744Gm14819Gm14850Gm14851Gm15023Gm15056Gm15070Gm15080Gm15085Gm15091Gm15093Gm15097Gm15104Gm15107Gm15114Gm16367Gm16381Gm16390Gm16404Gm16405Gm16430Gm16432Gm16442Gm1647Gm16501Gm166Gm1661Gm1673Gm1679Gm2030Gm216Gm2382Gm239Gm2506Gm266Gm2663Gm2696Gm2799Gm2825Gm2863Gm2897Gm2913Gm2933Gm3701Gm3706Gm3750Gm3763Gm3776Gm3985Gm4027Gm4070Gm410Gm4133Gm4141Gm4172Gm4175Gm4177Gm4179Gm4187Gm4201Gm4214Gm4788Gm4791Gm4794Gm4832Gm4836Gm4841Gm4846Gm4847Gm4858Gm4861Gm4871Gm4884Gm4894Gm4902Gm4906Gm4907Gm4922Gm4925Gm4937Gm514Gm5142Gm5148Gm5150Gm5168Gm5169Gm525Gm527Gm5294Gm5346Gm5347Gm5382Gm5414Gm5415Gm5416Gm5431Gm5458Gm5460Gm5662Gm572Gm5725Gm5726Gm5728Gm5741Gm5771Gm5797Gm5800Gm5803Gm581Gm5820Gm5868Gm5878Gm5885Gm5886Gm5887Gm5891Gm590Gm614Gm6164Gm6251Gm628Gm6289Gm6370Gm6377Gm6406Gm6408Gm6460Gm6484Gm6531Gm6537Gm6583Gm6588Gm6592Gm6614Gm7157Gm7168Gm7173Gm7244Gm7257Gm732Gm7325Gm749Gm7534Gm757Gm7616Gm765Gm766Gm7694Gm7714Gm773Gm7849Gm7861Gm7903Gm8882Gm889Gm8898Gm8909Gm8994Gm9Gm904Gm9047Gm906Gm9112Gm9125Gm9268Gm9376Gm94Gm9513Gm9524Gm962Gm97Gm16532Gm20172Gm16515Gm16517Gm14920Gm16445Gm16451Gm2022Gm5409Gm6222Gm7609Gm5894Gm14316Gm4934Gm5151Gm11428Gm1568Gm10058Gm10413Gm10439Gm1045Gm10471Gm10486Gm10487Gm10488Gm10591Gm106Gm10639Gm10665Gm10666Gm10670Gm10696Gm10697Gm10767Gm10778Gm10921Gm10922Gm11569Gm11595Gm11596Gm11710Gm11711Gm11744Gm11756Gm11757Gm11758Gm11818Gm11937Gm11938Gm11992Gm12Gm12169Gm12171Gm12185Gm12250Gm13057Gm13078Gm13083Gm13088Gm13102Gm13103Gm13109Gm13119Gm13124Gm13125Gm13128Gm13139Gm13152Gm13154Gm13157Gm13177Gm13178Gm1322Gm13305Gm13306Gm13308Gm1332Gm1337Gm13476Gm13547Gm136Gm13718Gm13871Gm13889Gm14085Gm14092Gm14124Gm14137Gm14139Gm14151Gm14288Gm14305Gm14446Gm14458Gm14459Gm14461Gm14483Gm14484Gm14501Gm14511Gm14525Gm14548Gm14632Gm15127Gm1527Gm15284Gm15292Gm15293Gm15308Gm15315Gm15319Gm15386Gm15455Gm156Gm1564Gm1574Gm1587Gm15881Gm1604bGm17019Gm1965Gm1987Gm1993Gm2002Gm2012Gm2016Gm20604Gm3238Gm3285Gm3286Gm3336Gm3417Gm3435Gm3448Gm3604Gm362Gm364Gm3646Gm3696Gm382Gm4216Gm4220Gm428Gm4297Gm4301Gm4302Gm4303Gm4305Gm4307Gm4312Gm4340Gm436Gm438Gm44Gm4498Gm4736Gm4745Gm4763Gm4787Gm4951Gm4952Gm4975Gm4980Gm4981Gm5072Gm5077Gm5082Gm5087Gm5111Gm5113Gm5114Gm5127Gm5128Gm5132Gm5134Gm5136Gm5464Gm5465Gm5483Gm5494Gm5506Gm5531Gm5538Gm5544Gm5567Gm5591Gm5592Gm5595Gm561Gm5615Gm5622Gm5634Gm5635Gm5640Gm5901Gm5916Gm5934Gm5935Gm5936Gm5938Gm5941Gm595Gm597Gm600Gm6026Gm6034Gm6040Gm606Gm608Gm6084Gm6086Gm6121Gm6696Gm6710Gm6760Gm6772Gm6792Gm6812Gm684Gm6878Gm6880Gm6890Gm6904Gm6907Gm7030Gm7073Gm7092Gm7102Gm711Gm7120Gm806Gm813Gm815Gm826Gm8267Gm829Gm8300Gm8369Gm8439Gm8453Gm853Gm8660Gm8677Gm8693Gm8720Gm8787Gm88Gm8817Gm884Gm9705Gm973Gm9733Gm9758Gm9992Gm17296Gm17365Gm17384Gm17495Gm17660Gm17677Gm17689Gm17727Gm20571Gm15299Gm4984Gm6927GM4738

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy