Recombinant Human GM2A

Cat.No. : GM2A-27454TH
Product Overview : Recombinant full length Human GM2A with N terminal proprietary tag. Predicted MW 47.3 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 193 amino acids
Description : This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants.
Molecular Weight : 47.300kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCD EGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPL KVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIP TGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELP SWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
Gene Name GM2A GM2 ganglioside activator [ Homo sapiens ]
Official Symbol GM2A
Synonyms GM2A; GM2 ganglioside activator; GM2 ganglioside activator protein; ganglioside GM2 activator; cerebroside sulfate activator protein; SAP 3; sphingolipid activator protein 3;
Gene ID 2760
mRNA Refseq NM_000405
Protein Refseq NP_000396
MIM 613109
Uniprot ID P17900
Chromosome Location 5q33.1
Pathway Lysosome, organism-specific biosystem; Lysosome, conserved biosystem;
Function beta-N-acetylhexosaminidase activity; sphingolipid activator protein activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GM2A Products

Required fields are marked with *

My Review for All GM2A Products

Required fields are marked with *

0
cart-icon