Recombinant Full Length Human GM2A Protein
| Cat.No. : | GM2A-199HF |
| Product Overview : | Recombinant full length Human GM2A with N terminal proprietary tag. Predicted MW 47.3 kDa |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 193 amino acids |
| Description : | This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants. |
| Form : | Liquid |
| Molecular Mass : | 47.300kDa inclusive of tags |
| AA Sequence : | MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCD EGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPL KVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIP TGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELP SWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | GM2A GM2 ganglioside activator [ Homo sapiens ] |
| Official Symbol | GM2A |
| Synonyms | GM2A; GM2 ganglioside activator; GM2 ganglioside activator protein; ganglioside GM2 activator; cerebroside sulfate activator protein; SAP 3; sphingolipid activator protein 3 |
| Gene ID | 2760 |
| mRNA Refseq | NM_000405 |
| Protein Refseq | NP_000396 |
| MIM | 613109 |
| UniProt ID | P17900 |
| ◆ Recombinant Proteins | ||
| GM2A-299C | Recombinant Cynomolgus Monkey GM2A Protein, His (Fc)-Avi-tagged | +Inquiry |
| GM2A-521H | Recombinant Human GM2A Protein, His-tagged | +Inquiry |
| GM2A-27456TH | Recombinant Human GM2A | +Inquiry |
| GM2A-556H | Recombinant Human GM2A protein, His-tagged | +Inquiry |
| GM2A-5366HF | Recombinant Full Length Human GM2A Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GM2A-450HCL | Recombinant Human GM2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GM2A Products
Required fields are marked with *
My Review for All GM2A Products
Required fields are marked with *
