"GPC1" Related Products

Expand
Expand

Recombinant Human GPC1

Cat.No.: GPC1-29027TH
Product Overview: Recombinant fragment of Human Glypican 1/ GPC1 with N terminal proprietary tag, 37.51kDa inclusive of tag.
Description: Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage.These proteins may play a role in the control of cell division and growth regulation.
Protein length: 108 amino acids
Molecular Weight: 37.510kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICP QGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQ LRSFDDHFQHLLNDSERTLQATFPGAFG
Sequence Similarities: Belongs to the glypican family.
Gene Name: GPC1 glypican 1 [ Homo sapiens ]
Official Symbol: GPC1
Synonyms: GPC1; glypican 1; glypican-1; glypican; glypican proteoglycan 1;
Gene ID: 2817
mRNA Refseq: NM_002081
Protein Refseq: NP_002072
MIM: 600395
Uniprot ID: P35052
Chromosome Location: 2q35-q37
Pathway: Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Glypican 1 network, organism-specific biosystem; Glypican pathway, organism-specific biosystem;
Function: heparan sulfate proteoglycan binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.