Recombinant Human IGFBP3 IGFBP3-26377TH

Recombinant Human IGFBP3

PRODUCTS

Home / Products / Recombinant Human IGFBP3

Recombinant Human IGFBP3

IGFBP3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : IGFBP3-26377TH
Product Overview : Recombinant full length Human IGFBP3 expressed in modified human 293 cells; amino acids 28-291 , Predicted MWt 28.7 kDa.
Description : This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Tissue specificity : Expressed by most tissues. Present in plasma.
Biological activity : Activity:The ED50 of IGFBP3-26377TH is typically 0.13-0.20 μg/ml as measured by its ability to neutralize rhIGF-II mediated proliferation of the MCF7 adenocarcinoma cell line.
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not rec
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage : Store at +4°C.
Sequences of amino acids : GASSGGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGC GCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQ ALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEED RSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAK DSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMED TLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
Sequence Similarities : Contains 1 IGFBP N-terminal domain.Contains 1 thyroglobulin type-1 domain.
Gene Name : IGFBP3 insulin-like growth factor binding protein 3 [ Homo sapiens ]
Official Symbol : IGFBP3
Synonyms : IGFBP3; insulin-like growth factor binding protein 3; insulin-like growth factor-binding protein 3; acid stable subunit of the 140 K IGF complex; binding protein 29; binding protein 53; BP 53; growth hormone dependent binding protein; IBP3; IGF binding pr
Gene ID : 3486
mRNA Refseq : NM_000598
Protein Refseq : NP_000589
MIM : 146732
Uniprot ID : P17936
Chromosome Location : 7p13-p12
Pathway : Diabetes pathways, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem;
Function : insulin-like growth factor I binding; insulin-like growth factor binding; metal ion binding; protein binding; protein tyrosine phosphatase activator activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy