Recombinant Human IGFBP3
Cat.No. : | IGFBP3-26377TH |
Product Overview : | Recombinant full length Human IGFBP3 expressed in modified human 293 cells; amino acids 28-291 , Predicted MWt 28.7 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 28-291 a.a. |
Description : | This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Tissue specificity : | Expressed by most tissues. Present in plasma. |
Biological activity : | Activity:The ED50 of IGFBP3-26377TH is typically 0.13-0.20 μg/ml as measured by its ability to neutralize rhIGF-II mediated proliferation of the MCF7 adenocarcinoma cell line. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not rec |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | GASSGGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGC GCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQ ALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEED RSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAK DSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMED TLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK |
Sequence Similarities : | Contains 1 IGFBP N-terminal domain.Contains 1 thyroglobulin type-1 domain. |
Full Length : | Full L. |
Gene Name | IGFBP3 insulin-like growth factor binding protein 3 [ Homo sapiens ] |
Official Symbol | IGFBP3 |
Synonyms | IGFBP3; insulin-like growth factor binding protein 3; insulin-like growth factor-binding protein 3; acid stable subunit of the 140 K IGF complex; binding protein 29; binding protein 53; BP 53; growth hormone dependent binding protein; IBP3; IGF binding pr |
Gene ID | 3486 |
mRNA Refseq | NM_000598 |
Protein Refseq | NP_000589 |
MIM | 146732 |
Uniprot ID | P17936 |
Chromosome Location | 7p13-p12 |
Pathway | Diabetes pathways, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; |
Function | insulin-like growth factor I binding; insulin-like growth factor binding; metal ion binding; protein binding; protein tyrosine phosphatase activator activity; |
◆ Recombinant Proteins | ||
IGFBP3-1410H | Recombinant Human IGFBP3 protein, His-tagged | +Inquiry |
IGFBP3-110I | Active Recombinant Human IGFBP3 Protein (264 aa) | +Inquiry |
Igfbp3-7M | Active Recombinant Mouse IGFBP3, carrier free | +Inquiry |
IGFBP3-1408H | Recombinant Human IGFBP3 protein, His-tagged | +Inquiry |
IGFBP3-8820C | Active Recombinant Cynomolgus IGFBP3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFBP3-2927HCL | Recombinant Human IGFBP3 cell lysate | +Inquiry |
IGFBP3-1230CCL | Recombinant Cynomolgus IGFBP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGFBP3 Products
Required fields are marked with *
My Review for All IGFBP3 Products
Required fields are marked with *
0
Inquiry Basket