Recombinant Human IGFBP3

Cat.No. : IGFBP3-26377TH
Product Overview : Recombinant full length Human IGFBP3 expressed in modified human 293 cells; amino acids 28-291 , Predicted MWt 28.7 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Protein Length : 28-291 a.a.
Description : This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Tissue specificity : Expressed by most tissues. Present in plasma.
Biological activity : Activity:The ED50 of IGFBP3-26377TH is typically 0.13-0.20 μg/ml as measured by its ability to neutralize rhIGF-II mediated proliferation of the MCF7 adenocarcinoma cell line.
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not rec
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage : Store at +4°C.
Sequences of amino acids : GASSGGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGC GCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQ ALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEED RSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAK DSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMED TLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
Sequence Similarities : Contains 1 IGFBP N-terminal domain.Contains 1 thyroglobulin type-1 domain.
Full Length : Full L.
Gene Name IGFBP3 insulin-like growth factor binding protein 3 [ Homo sapiens ]
Official Symbol IGFBP3
Synonyms IGFBP3; insulin-like growth factor binding protein 3; insulin-like growth factor-binding protein 3; acid stable subunit of the 140 K IGF complex; binding protein 29; binding protein 53; BP 53; growth hormone dependent binding protein; IBP3; IGF binding pr
Gene ID 3486
mRNA Refseq NM_000598
Protein Refseq NP_000589
MIM 146732
Uniprot ID P17936
Chromosome Location 7p13-p12
Pathway Diabetes pathways, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem;
Function insulin-like growth factor I binding; insulin-like growth factor binding; metal ion binding; protein binding; protein tyrosine phosphatase activator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGFBP3 Products

Required fields are marked with *

My Review for All IGFBP3 Products

Required fields are marked with *

0
cart-icon