"IL23A" Related Products

Expand
Expand

Recombinant Human IL23A

Cat.No.: IL23A-29782TH
Product Overview: Recombinant Human IL23 is a heterodimeric protein consisting of two subunits, p19 and p40 ; MWt 53.5 kDa.
Description: This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells.
Molecular Weight: 53.500kDa
Source: High-5 insect cells
Tissue specificity: Secreted by activated dendritic and phagocytic cells and keratinocytes. Also expressed by dermal Langerhans cells (at protein level).
Biological activity: Biological activity measured by the ability to induce IL-17 secretion by mouse splenocytes.
Form: Lyophilised:Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer co
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 1X PBS, pH 7.2
Storage: The lyophilized protein is stable at room temperature for up to 1 month. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C. Avoid repeated freeze/thaw cycles. See reconstitution notes
Sequences of amino acids: RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Sequence Similarities: Belongs to the IL-6 superfamily.
Gene Name: IL23A interleukin 23, alpha subunit p19 [ Homo sapiens ]
Official Symbol: IL23A
Synonyms: IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL 23; IL 23A; IL23P19; interleukin six; G CSF related factor; P19; SGRF;
Gene ID: 51561
mRNA Refseq: NM_016584
Protein Refseq: NP_057668
MIM: 605580
Uniprot ID: Q9NPF7
Chromosome Location: 12q13.13
Pathway: ATF-2 transcription factor network, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL23-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem;
Function: cytokine activity; contributes_to interleukin-23 receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.