Recombinant Mouse Il23a protein, His-tagged
| Cat.No. : | Il23a-2461M |
| Product Overview : | Recombinant Mouse Il23a protein(Q9EQ14)(22-196aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 22-196aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 23.7 kDa |
| AA Sequence : | VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Il23a interleukin 23, alpha subunit p19 [ Mus musculus ] |
| Official Symbol | Il23a |
| Synonyms | IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL-23-A; IL-23p19; IL-23 subunit alpha; interleukin-23 subunit p19; p19; IL-23; |
| Gene ID | 83430 |
| mRNA Refseq | NM_031252 |
| Protein Refseq | NP_112542 |
| ◆ Recombinant Proteins | ||
| IL23A-1823H | Active Recombinant Human IL23A protein, His & Avi-tagged, Biotinylated | +Inquiry |
| IL23A-451H | Recombinant Human IL23A Protein, Fc-tagged | +Inquiry |
| Il23a-651M | Active Recombinant Mouse Interleukin 23, Alpha Subunit P19 | +Inquiry |
| IL23A-5832H | Recombinant Human IL23 Protein (Arg20-Pro189, Ile23-Ser328), C-His and C-Flag tagged | +Inquiry |
| Il23A-23H | Recombinant Human Il23A&IL12B Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL23A-5231HCL | Recombinant Human IL23A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All Il23a Products
Required fields are marked with *
My Review for All Il23a Products
Required fields are marked with *