Recombinant Mouse Il23a protein, His-tagged

Cat.No. : Il23a-2461M
Product Overview : Recombinant Mouse Il23a protein(Q9EQ14)(22-196aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 22-196aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 23.7 kDa
AA Sequence : VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name Il23a interleukin 23, alpha subunit p19 [ Mus musculus ]
Official Symbol Il23a
Synonyms IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL-23-A; IL-23p19; IL-23 subunit alpha; interleukin-23 subunit p19; p19; IL-23;
Gene ID 83430
mRNA Refseq NM_031252
Protein Refseq NP_112542

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (1)

Customer Reviews

Write a review

Q&As

Ask a question

Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit? 02/01/2023

Please inquiry our product manager with specific product.

Ask a Question for All Il23a Products

Required fields are marked with *

My Review for All Il23a Products

Required fields are marked with *

0

Inquiry Basket

cartIcon