Recombinant Mouse Il23a protein, His-tagged

• Cat.No.: Il23a-2461M
• Product Overview: Recombinant Mouse Il23a protein(Q9EQ14)(22-196aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 22-196aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 23.7 kDa
• AA Sequence: VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: Il23a interleukin 23, alpha subunit p19 [ Mus musculus ]
• Official Symbol: Il23a
• Synonyms: IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL-23-A; IL-23p19; IL-23 subunit alpha; interleukin-23 subunit p19; p19; IL-23
• Gene ID: 83430
• mRNA Refseq: NM_031252
• Protein Refseq: NP_112542

Q&As

Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit?

Please inquiry our product manager with specific product.