Recombinant Mouse Il23a protein, His-tagged
Cat.No. : | Il23a-2461M |
Product Overview : | Recombinant Mouse Il23a protein(Q9EQ14)(22-196aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-196aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.7 kDa |
AA Sequence : | VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Il23a interleukin 23, alpha subunit p19 [ Mus musculus ] |
Official Symbol | Il23a |
Synonyms | IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL-23-A; IL-23p19; IL-23 subunit alpha; interleukin-23 subunit p19; p19; IL-23; |
Gene ID | 83430 |
mRNA Refseq | NM_031252 |
Protein Refseq | NP_112542 |
◆ Recombinant Proteins | ||
IL23A-3545H | Recombinant Human IL23A Protein (Arg20-Pro189), His tagged | +Inquiry |
IL23A-29781TH | Recombinant Human IL23A, FLAG-tagged | +Inquiry |
IL23A-2067R | Recombinant Rhesus Macaque IL23A Protein, His (Fc)-Avi-tagged | +Inquiry |
Il23A-001H | Active Recombinant Human Il23A, HIgG1 Fc-tagged, mutant | +Inquiry |
IL23A-1327P | Recombinant Pig IL23A Full Length Transmembrane protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL23A-5231HCL | Recombinant Human IL23A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (1)
Ask a question
Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit?
02/01/2023
Please inquiry our product manager with specific product.
Ask a Question for All Il23a Products
Required fields are marked with *
My Review for All Il23a Products
Required fields are marked with *
0
Inquiry Basket