"MAPK3" Related Products

Expand
Expand
Expand

Recombinant Human MAPK3

Cat.No.: MAPK3-28699TH
Product Overview: Recombinant full length protein corresponding to amino acids 2-379 of Human ERK1, with an N-terminal proprietary tag; predicted MWt 69.8 kDa inclusive of tag.Residue A232 of the fusion protein is equivalent to A2 of the native enzyme. Protease cleavage si
Description: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described.
Protein length: 378 amino acids
Molecular Weight: 69.800kDa inclusive of tags
Source: E. coli
Biological activity: Specific activity: 379.25 units/ml;621.73 Units/mg
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 7.50Constituents:0.79% Tris HCl, 9.24% Sucrose, 0.88% Sodium chloride, 0.003% EGTA, 0.1% Beta mercaptoethanol, 0.002% Brij, 0.012% Benzamidine, 0.003% PMSF
Storage: Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDK WRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKV DFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSAAAAAQGGG GGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGE GAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQ ILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLY KLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPS NLLSNTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWY RAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHY LDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKV AWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYL EQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETAR FQPGVLEAP
Sequence Similarities: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.Contains 1 protein kinase domain.
Gene Name: MAPK3 mitogen-activated protein kinase 3 [ Homo sapiens ]
Official Symbol: MAPK3
Synonyms: MAPK3; mitogen-activated protein kinase 3; PRKM3; ERK1; p44erk1; p44mapk;
Gene ID: 5595
mRNA Refseq: NM_001040056
Protein Refseq: NP_001035145
MIM: 601795
Uniprot ID: P27361
Chromosome Location: 16p11.2
Pathway: ALK1 signaling events, organism-specific biosystem; ARMS-mediated activation, organism-specific biosystem; ATF-2 transcription factor network, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of the AP-1 family of transcription factors, organism-specific biosystem;
Function: ATP binding; MAP kinase activity; MAP kinase activity; nucleotide binding; phosphatase binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.