"MSX2" Related Products

Expand
Expand
Expand

Recombinant Human MSX2

Cat.No.: MSX2-29500TH
Product Overview: Recombinant fragment of Human Msx2/Hox8 with N terminal proprietary tag, predicted mwt: 40.26 kDa.
Description: This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2.
Protein length: 133 amino acids
Molecular Weight: 40.260kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRV KVSSLPFSVEALMSDKKPPKEASPLPAESASAGATLRPLL LSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPG RYSPPPRHTSPTT
Sequence Similarities: Belongs to the Msh homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name: MSX2 msh homeobox 2 [ Homo sapiens ]
Official Symbol: MSX2
Synonyms: MSX2; msh homeobox 2; msh (Drosophila) homeo box homolog 2 , msh homeobox homolog 2 (Drosophila) , parietal foramina 1 , PFM1; homeobox protein MSX-2; craniosynostosis; type 2; CRS2; FPP; HOX8; MSH; PFM;
Gene ID: 4488
mRNA Refseq: NM_002449
Protein Refseq: NP_002440
MIM: 123101
Uniprot ID: P35548
Chromosome Location: 5q35.2
Pathway: HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function: protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding; transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.