"PHPT1" Related Products

Expand
Expand

Recombinant Human PHPT1, His-tagged

Cat.No. : PHPT1-29584TH
Product Overview : Recombinant full length Human PHPT1 with an N terminal His tag; 145 amino acids with a predicted MWt 15.9kDa including tag,.
Description : PHPT1 is an EDTA-insensitive phosphohistidine phosphatase that catalyzes the dephosphorylation of phosphopeptide I (Ek et al.
Protein length : 125 amino acids
Conjugation : HIS
Molecular Weight : 15.900kDa
Source : E. coli
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Gene Name : PHPT1 phosphohistidine phosphatase 1 [ Homo sapiens ]
Official Symbol : PHPT1
Synonyms : PHPT1; phosphohistidine phosphatase 1; 14 kDa phosphohistidine phosphatase; sex regulated protein janus a; bA216L13.10; CGI 202; DKFZp564M173; HSPC141; phosphohistidine phosphatase 14kDa; PHP14;
Gene ID : 29085
mRNA Refseq : NM_001135861
Protein Refseq : NP_001129333
MIM : 610167
Uniprot ID : Q9NRX4
Chromosome Location : 9q34.3
Pathway : Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem;
Function : calcium channel inhibitor activity; hydrolase activity; ion channel binding; phosphohistidine phosphatase activity; phosphohistidine phosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.