Recombinant Human PHPT1, His-tagged
Cat.No. : | PHPT1-29584TH |
Product Overview : | Recombinant full length Human PHPT1 with an N terminal His tag; 145 amino acids with a predicted MWt 15.9kDa including tag,. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 125 amino acids |
Description : | PHPT1 is an EDTA-insensitive phosphohistidine phosphatase that catalyzes the dephosphorylation of phosphopeptide I (Ek et al. |
Conjugation : | HIS |
Molecular Weight : | 15.900kDa |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY |
Gene Name | PHPT1 phosphohistidine phosphatase 1 [ Homo sapiens ] |
Official Symbol | PHPT1 |
Synonyms | PHPT1; phosphohistidine phosphatase 1; 14 kDa phosphohistidine phosphatase; sex regulated protein janus a; bA216L13.10; CGI 202; DKFZp564M173; HSPC141; phosphohistidine phosphatase 14kDa; PHP14; |
Gene ID | 29085 |
mRNA Refseq | NM_001135861 |
Protein Refseq | NP_001129333 |
MIM | 610167 |
Uniprot ID | Q9NRX4 |
Chromosome Location | 9q34.3 |
Pathway | Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; |
Function | calcium channel inhibitor activity; hydrolase activity; ion channel binding; phosphohistidine phosphatase activity; phosphohistidine phosphatase activity; |
◆ Recombinant Proteins | ||
PHPT1-800H | Recombinant Human PhosphoHistidine Phosphatase 1, His-tagged | +Inquiry |
PHPT1-1692H | Recombinant Human PHPT1, GST-tagged | +Inquiry |
PHPT1-753H | Recombinant Human PHPT1 Protein, His-tagged | +Inquiry |
PHPT1-2207H | Recombinant Human PHPT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PHPT1-4218H | Recombinant Human PHPT1 Protein (Met1-Tyr125), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHPT1-3215HCL | Recombinant Human PHPT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PHPT1 Products
Required fields are marked with *
My Review for All PHPT1 Products
Required fields are marked with *
0
Inquiry Basket