Recombinant Human PHPT1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PHPT1-2207H
Product Overview : PHPT1 MS Standard C13 and N15-labeled recombinant protein (NP_054891) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation and inhibition of KCa3.1 channels. Alternative splicing results in multiple transcript variants.
Molecular Mass : 13.8 kDa
AA Sequence : MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PHPT1 phosphohistidine phosphatase 1 [ Homo sapiens (human) ]
Official Symbol PHPT1
Synonyms PHPT1; phosphohistidine phosphatase 1; 14 kDa phosphohistidine phosphatase; sex regulated protein janus a; bA216L13.10; CGI 202; DKFZp564M173; HSPC141; phosphohistidine phosphatase 14kDa; PHP14; 1700008C22Rik; protein janus-A homolog; sex-regulated protein janus-a; CGI-202; RP11-216L13.10;
Gene ID 29085
mRNA Refseq NM_014172
Protein Refseq NP_054891
MIM 610167
UniProt ID Q9NRX4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PHPT1 Products

Required fields are marked with *

My Review for All PHPT1 Products

Required fields are marked with *

0
cart-icon