Recombinant Human PHPT1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PHPT1-2207H
• Product Overview: PHPT1 MS Standard C13 and N15-labeled recombinant protein (NP_054891) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation and inhibition of KCa3.1 channels. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 13.8 kDa
• AA Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PHPT1 phosphohistidine phosphatase 1 [ Homo sapiens (human) ]
• Official Symbol: PHPT1
• Synonyms: PHPT1; phosphohistidine phosphatase 1; 14 kDa phosphohistidine phosphatase; sex regulated protein janus a; bA216L13.10; CGI 202; DKFZp564M173; HSPC141; phosphohistidine phosphatase 14kDa; PHP14; 1700008C22Rik; protein janus-A homolog; sex-regulated protein janus-a; CGI-202; RP11-216L13.10
• Gene ID: 29085
• mRNA Refseq: NM_014172
• Protein Refseq: NP_054891
• MIM: 610167
• UniProt ID: Q9NRX4