Recombinant Human PPP1CA, His-tagged

• Cat.No.: PPP1CA-27568TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-330 of Human PPP1A with N terminal His tag, 330 amino acids, 38kDa.

Specification

• Description: The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 148 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCL KSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEY GGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPE NFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTD CFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRP TDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAE VVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFS APNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKY GQFSGLNPGGRPITPPRNSAKAKK
• Sequence Similarities: Belongs to the PPP phosphatase family. PP-1 subfamily.

Gene Information

• Gene Name: PPP1CA protein phosphatase 1, catalytic subunit, alpha isozyme [ Homo sapiens ]
• Official Symbol: PPP1CA
• Synonyms: PPP1CA; protein phosphatase 1, catalytic subunit, alpha isozyme; PPP1A, protein phosphatase 1, catalytic subunit, alpha isoform; serine/threonine-protein phosphatase PP1-alpha catalytic subunit; PP 1A; PP1alpha
• Gene ID: 5499
• mRNA Refseq: NM_001008709
• Protein Refseq: NP_001008709
• MIM: 176875
• Uniprot ID: P62136
• Chromosome Location: 11q13
• Pathway: ALK1 signaling events, organism-specific biosystem; BMP receptor signaling, organism-specific biosystem; DARPP-32 events, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem
• Function: hydrolase activity; metal ion binding; protein binding; protein phosphatase type 1 regulator activity; protein serine/threonine phosphatase activity