"PPP1CA" Related Products

Expand

Recombinant Human PPP1CA, His-tagged

Cat.No.: PPP1CA-27568TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-330 of Human PPP1A with N terminal His tag, 330 amino acids, 38kDa.
Description: The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCL KSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEY GGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPE NFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTD CFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRP TDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAE VVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFS APNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKY GQFSGLNPGGRPITPPRNSAKAKK
Sequence Similarities: Belongs to the PPP phosphatase family. PP-1 subfamily.
Gene Name: PPP1CA protein phosphatase 1, catalytic subunit, alpha isozyme [ Homo sapiens ]
Official Symbol: PPP1CA
Synonyms: PPP1CA; protein phosphatase 1, catalytic subunit, alpha isozyme; PPP1A, protein phosphatase 1, catalytic subunit, alpha isoform; serine/threonine-protein phosphatase PP1-alpha catalytic subunit; PP 1A; PP1alpha;
Gene ID: 5499
mRNA Refseq: NM_001008709
Protein Refseq: NP_001008709
MIM: 176875
Uniprot ID: P62136
Chromosome Location: 11q13
Pathway: ALK1 signaling events, organism-specific biosystem; BMP receptor signaling, organism-specific biosystem; DARPP-32 events, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem;
Function: hydrolase activity; metal ion binding; protein binding; protein phosphatase type 1 regulator activity; protein serine/threonine phosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.