Recombinant Dog PPP1CA Protein (2-330 aa), His-Myc-tagged
Cat.No. : | PPP1CA-2523D |
Product Overview : | Recombinant Dog PPP1CA Protein (2-330 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-330 aa |
Description : | Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Regulates NEK2 function in terms of kinase activity and centrosome number and splitting, both in the presence and absence of radiation-induced DNA damage. Regulator of neural tube and optic fissure closure, and enteric neural crest cell (ENCCs) migration during development. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates CENPA. Dephosphorylates the 'Ser-139' residue of ATG16L1 causing dissociation of ATG12-ATG5-ATG16L1 complex, thereby inhibiting autophagy. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 42.3 kDa |
AA Sequence : | SDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDSFNSLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | PPP1CA protein phosphatase 1, catalytic subunit, alpha isozyme [ Canis lupus familiaris ] |
Official Symbol | PPP1CA |
Synonyms | PPP1CA; PP-1A; protein phosphatase 1, catalytic subunit, alpha isoform; |
Gene ID | 403609 |
mRNA Refseq | NM_001003064 |
Protein Refseq | NP_001003064 |
UniProt ID | Q8WMS6 |
◆ Recombinant Proteins | ||
PPP1CA-1015H | Recombinant Full Length Human PPP1CA, His-tagged | +Inquiry |
PPP1CA-31049TH | Recombinant Human PPP1CA, His-tagged | +Inquiry |
PPP1CA-6999M | Recombinant Mouse PPP1CA Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1CA-13209M | Recombinant Mouse PPP1CA Protein | +Inquiry |
PPP1CA-4270R | Recombinant Rat PPP1CA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1CA-2953HCL | Recombinant Human PPP1CA 293 Cell Lysate | +Inquiry |
PPP1CA-2951HCL | Recombinant Human PPP1CA 293 Cell Lysate | +Inquiry |
PPP1CA-2952HCL | Recombinant Human PPP1CA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP1CA Products
Required fields are marked with *
My Review for All PPP1CA Products
Required fields are marked with *
0
Inquiry Basket