Recombinant Human PPP2R4, His-tagged

• Cat.No.: PPP2R4-27572TH
• Product Overview: Recombinant fragment, corresponding to amino acids 104-323 of Human PPP2R4 Isoform 1 with an N-terminal His tag; Predicted MWt 26 kDa.

Specification

• Description: Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B/PR61, and B/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Widely expressed.
• Form: Lyophilised:Reconstitute with 125 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: AYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESV GNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIV FKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLP FIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECI LFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKA ECLEKFPVIQHFKFGSLLPIHPVTSG
• Sequence Similarities: Belongs to the PTPA-type PPIase family.

Gene Information

• Gene Name: PPP2R4 protein phosphatase 2A activator, regulatory subunit 4 [ Homo sapiens ]
• Official Symbol: PPP2R4
• Synonyms: PPP2R4; protein phosphatase 2A activator, regulatory subunit 4; protein phosphatase 2A, regulatory subunit B (PR 53); serine/threonine-protein phosphatase 2A activator; phosphotyrosyl phosphatase activator; PP2A phosphatase activator; PR53; PTPA
• Gene ID: 5524
• mRNA Refseq: NM_001193397
• Protein Refseq: NP_001180326
• MIM: 600756
• Uniprot ID: Q15257
• Chromosome Location: 9q34
• Pathway: Glycogen Metabolism, organism-specific biosystem; IL-6 Signaling Pathway, organism-specific biosystem; Validated targets of C-MYC transcriptional repression, organism-specific biosystem; Wnt Signaling Pathway and Pluripotency, organism-specific biosystem; p53 pathway, organism-specific biosystem
• Function: ATP binding; contributes_to ATPase activity; isomerase activity; nucleotide binding; peptidyl-prolyl cis-trans isomerase activity