"PPP2R4" Related Products

Expand

Recombinant Human PPP2R4, His-tagged

Cat.No.: PPP2R4-27572TH
Product Overview: Recombinant fragment, corresponding to amino acids 104-323 of Human PPP2R4 Isoform 1 with an N-terminal His tag; Predicted MWt 26 kDa.
Description: Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B/PR61, and B/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed.
Form: Lyophilised:Reconstitute with 125 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESV GNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIV FKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLP FIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECI LFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKA ECLEKFPVIQHFKFGSLLPIHPVTSG
Sequence Similarities: Belongs to the PTPA-type PPIase family.
Gene Name: PPP2R4 protein phosphatase 2A activator, regulatory subunit 4 [ Homo sapiens ]
Official Symbol: PPP2R4
Synonyms: PPP2R4; protein phosphatase 2A activator, regulatory subunit 4; protein phosphatase 2A, regulatory subunit B (PR 53); serine/threonine-protein phosphatase 2A activator; phosphotyrosyl phosphatase activator; PP2A phosphatase activator; PR53; PTPA;
Gene ID: 5524
mRNA Refseq: NM_001193397
Protein Refseq: NP_001180326
MIM: 600756
Uniprot ID: Q15257
Chromosome Location: 9q34
Pathway: Glycogen Metabolism, organism-specific biosystem; IL-6 Signaling Pathway, organism-specific biosystem; Validated targets of C-MYC transcriptional repression, organism-specific biosystem; Wnt Signaling Pathway and Pluripotency, organism-specific biosystem; p53 pathway, organism-specific biosystem;
Function: ATP binding; contributes_to ATPase activity; isomerase activity; nucleotide binding; peptidyl-prolyl cis-trans isomerase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.