Recombinant Human RRAS
Cat.No. : | RRAS-30771TH |
Product Overview : | Recombinant full length Human RRAS with N terminal proprietary tag; Predicted MWt 50.50 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | Ras-related protein R-Ras is a protein that in humans is encoded by the RRAS gene. |
Protein length : | 218 amino acids |
Molecular Weight : | 50.500kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGV GKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGIPARLD ILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAF GASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPP SPPSAPRKKGGGCPCVLL |
Sequence Similarities : | Belongs to the small GTPase superfamily. Ras family. |
Gene Name : | RRAS related RAS viral (r-ras) oncogene homolog [ Homo sapiens ] |
Official Symbol : | RRAS |
Synonyms : | RRAS; related RAS viral (r-ras) oncogene homolog; ras-related protein R-Ras; Oncogene RRAS; |
Gene ID : | 6237 |
mRNA Refseq : | NM_006270 |
Protein Refseq : | NP_006261 |
MIM : | 165090 |
Uniprot ID : | P10301 |
Chromosome Location : | 19q13.3-qter |
Pathway : | Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Axon guidance, organism-specific biosystem; CREB phosphorylation through the activation of Ras, organism-specific biosystem; Developmental Biology, organism-specific biosystem; EPHB forward signaling, organism-specific biosystem; |
Function : | GDP binding; GTP binding; GTPase activity; nucleotide binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
RRAS-4839R | Recombinant Rat RRAS Protein, His (Fc)-Avi-tagged | +Inquiry |
Rras-5623M | Recombinant Mouse Rras Protein, Myc/DDK-tagged | +Inquiry |
RRAS-7809M | Recombinant Mouse RRAS Protein, His (Fc)-Avi-tagged | +Inquiry |
RRAS-1920H | Recombinant Human RRAS Protein, His (Fc)-Avi-tagged | +Inquiry |
RRAS-5180R | Recombinant Rat RRAS Protein | +Inquiry |
◆ Lysates | ||
RRAS-2144HCL | Recombinant Human RRAS 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket