"RRAS" Related Products

Expand
Expand

Recombinant Human RRAS

Cat.No.: RRAS-30771TH
Product Overview: Recombinant full length Human RRAS with N terminal proprietary tag; Predicted MWt 50.50 kDa including the tag.
Description: Ras-related protein R-Ras is a protein that in humans is encoded by the RRAS gene.
Protein length: 218 amino acids
Molecular Weight: 50.500kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGV GKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGIPARLD ILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAF GASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPP SPPSAPRKKGGGCPCVLL
Sequence Similarities: Belongs to the small GTPase superfamily. Ras family.
Gene Name: RRAS related RAS viral (r-ras) oncogene homolog [ Homo sapiens ]
Official Symbol: RRAS
Synonyms: RRAS; related RAS viral (r-ras) oncogene homolog; ras-related protein R-Ras; Oncogene RRAS;
Gene ID: 6237
mRNA Refseq: NM_006270
Protein Refseq: NP_006261
MIM: 165090
Uniprot ID: P10301
Chromosome Location: 19q13.3-qter
Pathway: Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Axon guidance, organism-specific biosystem; CREB phosphorylation through the activation of Ras, organism-specific biosystem; Developmental Biology, organism-specific biosystem; EPHB forward signaling, organism-specific biosystem;
Function: GDP binding; GTP binding; GTPase activity; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.