Recombinant Human RRAS
Cat.No. : | RRAS-30771TH |
Product Overview : | Recombinant full length Human RRAS with N terminal proprietary tag; Predicted MWt 50.50 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 218 amino acids |
Description : | Ras-related protein R-Ras is a protein that in humans is encoded by the RRAS gene. |
Molecular Weight : | 50.500kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGV GKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGIPARLD ILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAF GASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPP SPPSAPRKKGGGCPCVLL |
Sequence Similarities : | Belongs to the small GTPase superfamily. Ras family. |
Gene Name | RRAS related RAS viral (r-ras) oncogene homolog [ Homo sapiens ] |
Official Symbol | RRAS |
Synonyms | RRAS; related RAS viral (r-ras) oncogene homolog; ras-related protein R-Ras; Oncogene RRAS; |
Gene ID | 6237 |
mRNA Refseq | NM_006270 |
Protein Refseq | NP_006261 |
MIM | 165090 |
Uniprot ID | P10301 |
Chromosome Location | 19q13.3-qter |
Pathway | Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Axon guidance, organism-specific biosystem; CREB phosphorylation through the activation of Ras, organism-specific biosystem; Developmental Biology, organism-specific biosystem; EPHB forward signaling, organism-specific biosystem; |
Function | GDP binding; GTP binding; GTPase activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
RRAS-1465Z | Recombinant Zebrafish RRAS | +Inquiry |
RRAS-5180R | Recombinant Rat RRAS Protein | +Inquiry |
RRAS-449HF | Recombinant Full Length Human RRAS Protein | +Inquiry |
RRAS-2170HFL | Recombinant Full Length Human RRAS Protein, C-Flag-tagged | +Inquiry |
RRAS-30771TH | Recombinant Human RRAS | +Inquiry |
◆ Cell & Tissue Lysates | ||
RRAS-2144HCL | Recombinant Human RRAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RRAS Products
Required fields are marked with *
My Review for All RRAS Products
Required fields are marked with *